Тёмный
Nicoville20
Nicoville20
Nicoville20
Подписаться
Twentieth Century Nicoville Studios. Home to high quality AMVs featuring cartoons and anime in a variety of shorts and musical moments from the classical era to broadway
The Battle Hymn of The Republic (AMV/CMV)
5:57
3 месяца назад
Sing (AMV/CMV/PMV)
4:08
3 месяца назад
Theme/March From "Superman" (AMV/CMV)
5:21
5 месяцев назад
Steamboat Bill (Steamboat Willie Parody)
9:07
8 месяцев назад
It’s a Mad, Mad, Mad, Mad World! (AMV/CMV/PMV)
3:18
10 месяцев назад
An Original Suite (AMV/CMV)
11:10
Год назад
Carmen Suite No.1 (AMV/CMV/PMV)
13:04
Год назад
The Typewriter (AMV/CMV)
2:32
2 года назад
Shorts from TikTok (AMV Short)
2:53
2 года назад
Gay or European (AMV/CMV/PMV)
5:12
2 года назад
Second Suite in F (AMV/CMV/PMV)
12:21
2 года назад
Sixteen Tons (AMV/CMV)
3:13
2 года назад
This is Child Labor! (AMV Short)
1:25
2 года назад
Комментарии
@jason5315
@jason5315 15 дней назад
This will light a fire under your ass but there is better cartoons
@ElijahHarris-p7j
@ElijahHarris-p7j 16 дней назад
Go army
@DoctorLivsey-q9e
@DoctorLivsey-q9e Месяц назад
Why did you show up something that doesn't make sense?!
@masonpines6349
@masonpines6349 Месяц назад
3:54-4:58. THAT. That's what I want out this new deal Mr. Gunn. That's the Superman movie we need.
@pangpek5645
@pangpek5645 Месяц назад
❤❤❤ ❤❤❤ ❤❤❤ ❤❤ our olympic bronze medalist for kitefoiling, Max Maeder, representing Singapore, youngest medalist - 17 years old - Paris Olymics 2024 (Gold : Austria .. Silver: Slovenia) listened to this .. before race 🎉🎉🎉🎉
@ul7185
@ul7185 2 месяца назад
Request: Light Cavalry Overture (AMV/CMV/PMV)
@christopheracosta2043
@christopheracosta2043 3 месяца назад
God Bless America!
@rosendoandangel
@rosendoandangel 3 месяца назад
Happy Independence Day! 🎆🇺🇸
@rosendoandangel
@rosendoandangel 3 месяца назад
Marvellous video!!😁👍
@nicoville20
@nicoville20 3 месяца назад
So far, this AMV is getting good viewrship! I'm glad people see this as wholesome soft patriotism rather than military propaganda. Please enjoy all of my other AMV offerings, the 4th of July stuff seems to hit out of the park every year and I would appreciate everyone checking out my other content! Especially next week with a new AMV being released!
@parkerheinle9132
@parkerheinle9132 3 месяца назад
Goosebumps absolutely amazing and so beautiful
@lo-dv3eu
@lo-dv3eu 3 месяца назад
hurrah
@pimpdaddyo5920
@pimpdaddyo5920 3 месяца назад
Love the clips. They fit really well with the music.
@Sandlot1992
@Sandlot1992 3 месяца назад
Brilliant and Epic!
@rosendoandangel
@rosendoandangel 3 месяца назад
I love the William Shatner part so much!
@rosendoandangel
@rosendoandangel 3 месяца назад
Great trailer!😁
@Hibublub
@Hibublub 4 месяца назад
What is this…
@nicoville20
@nicoville20 4 месяца назад
Madness, pure madness.
@Blazedeath597
@Blazedeath597 4 месяца назад
POV: *you just sent a telegram to Mexico saying to attack America, but the British intercept the message and send it to the Americans:* Germans: *OH FUCK!*
@angelagokool9514
@angelagokool9514 4 месяца назад
😂 I love ❤️ it! I love just how many 90s references were being used. I don’t know much about anime, but it was funny how it was being used to represent the Japanese during World War Two.
@glendarivera9625
@glendarivera9625 4 месяца назад
1:56
@seeyachump4513
@seeyachump4513 4 месяца назад
We lost the war
@nicoville20
@nicoville20 4 месяца назад
The heck do you mean “we lost the war”?
@joegaito702
@joegaito702 4 месяца назад
I get thrills and chills watching this to all the branches who serve us your service and time and efforts are deeply appreciated thanks great job great team work and great and sweet catches as usual still going great team efforts are deeply appreciated thanks please come home safely much love and respect and appreciation job well done you should be amazed and proud I try not to teary eyed and emotional great music and singing very impressed thanks stay safe and warm out there stay strong as well !!: Joe
@joegaito702
@joegaito702 4 месяца назад
To all the branches who serve us your service and time and efforts are deeply appreciated thanks great job great team work and great and sweet catches as usual still going strong great team efforts are deeply appreciated even by everyone who responds stay safe and warm out there stay strong as well much love and respect and appreciation job well done you should be amazed and proud way to go proud to be American thanks !!! Joe
@justincartledge111
@justincartledge111 4 месяца назад
The drawing was good for that time
@Sandlot1992
@Sandlot1992 4 месяца назад
Awesome Video! plus that clip from Caillou killed me!
@CartoonNetworkTwo
@CartoonNetworkTwo 5 месяцев назад
Nice work.
@nicoville20
@nicoville20 5 месяцев назад
Oh my gosh! Praise from Ceaser! Have been a fan of yours for a long time back in the day!
@JodaroKujo
@JodaroKujo 5 месяцев назад
“On my world it means hope”
@Helldiver_1
@Helldiver_1 5 месяцев назад
Love the video but why did you add Eric Cartman as Hitler ._.
@nicoville20
@nicoville20 5 месяцев назад
Because Hitler is a tyrant and both he and Cartman are evil? You don’t think the opposite do you? .___.
@nicoville20
@nicoville20 Месяц назад
Yeah. That’s what I thought ._______________________.
@nickwilson306
@nickwilson306 5 месяцев назад
i love the hunchback of notre dame
@adscomics
@adscomics 5 месяцев назад
4:56 when Superman smiles at the camera here, it's impossible not to smile back.
@rosendoandangel
@rosendoandangel 5 месяцев назад
Brilliant performance!
@disneyvillainrocket1
@disneyvillainrocket1 5 месяцев назад
Epic
@benanasarias3856
@benanasarias3856 6 месяцев назад
Hi can you make UNited states space force theme for the memorial day?
@EllislovesCrossovers
@EllislovesCrossovers 6 месяцев назад
You got me XD
@rosendoandangel
@rosendoandangel 6 месяцев назад
(Laughing)🤣 That was a good April Fools joke!
@marytijerina9764
@marytijerina9764 6 месяцев назад
Well, that escalated quickly
@nicoville20
@nicoville20 6 месяцев назад
CONTEXT: There used to be a channel that bore my name without permission, and it was just reused footage of my AMVs but with added kiddie shows (such as Mona in the thumbnail. The amvs made were pretty childish, but I am more of a mature more eloquent AMV maker. The channel since changed its name but I was shocked when I found out about this channel. Hence why I made this April fools video
@jordonlee9162
@jordonlee9162 6 месяцев назад
Fairy tail perfect choice
@marytijerina9764
@marytijerina9764 6 месяцев назад
Meanwhile, Alfred Jones is flying away with his ill-gotten money Pilot:Folks, this is your captain speaking, our flight will be making a brief layover in Acme Falls Alfred: Acme Falls, where have I heard that name before?...*remembers* Oh,no, Oh, no! Angry townspeople:There he is! *storm into the plane* Seat 3-F! *Proceed to beat Alfred to death*
@DavidBall-fd8og
@DavidBall-fd8og 6 месяцев назад
NAVY, AIR FORCE, MARINE CORPS, COAST GUARD, ARMY 🎉🎉🎉🎉🎉🎉🎉🎉🎉🎉🎉🎉🎉🎉🎉🎉🎉😢😢🎉🎉🎉🎉🎉🎉🎉🎉🎉🎉🎉🎉🎉 FMTDYTFFYTTYMFFTMYFDGCFDFGFDNNTDGTDYRMYTGRDGgffsfbdsffsdghfyhtdmytdydtyerueygjaehkggyjwdhwdthgfwewehdngfnedwthnsaheftnfwthshwwawhefttsmhwftfwhwfthqwstystwfqqqwgjywjqsguqswjgyajsygsawyj 3:50
@JustaAm3rican
@JustaAm3rican 6 месяцев назад
rare anime w
@marytijerina9764
@marytijerina9764 7 месяцев назад
Stewie: Brian, why does everything you touch turn to garbage?
@cuedepie4376
@cuedepie4376 7 месяцев назад
Actually well made and catchy.
@UAndZoni
@UAndZoni 7 месяцев назад
Nicoville Guy
@pastapower979
@pastapower979 8 месяцев назад
Oh god.. Brian's voice oddly fits WAY too well on Yakko..
@ClermontStudiosFlorida
@ClermontStudiosFlorida 8 месяцев назад
Thanks for the censored
@EIBozo
@EIBozo 8 месяцев назад
if u made this then mad respect but even if u didnt nice to see people are for once not using mickeys public domainess to make horror
@nicoville20
@nicoville20 8 месяцев назад
I just made the title cards, it’s just Steamboat Willie, but made to look like a silent picture
@EIBozo
@EIBozo 8 месяцев назад
oh, atleast for once people are using its public domain to not post horror@@nicoville20
@basicallysnake
@basicallysnake 8 месяцев назад
@@nicoville20you could also do the Oswald thing where they spoke in comic speech bubbles
@andresdorta1236
@andresdorta1236 9 месяцев назад
We all know That Steamboat Willy Is in a Public Domain So Everyone Can Use it
@nicoville20
@nicoville20 9 месяцев назад
I mean, duh. That’s the joke
@andresdorta1236
@andresdorta1236 8 месяцев назад
@@nicoville20 good
@GeeksGets
@GeeksGets 8 месяцев назад
??? ​@@andresdorta1236
@jordanstrickland1149
@jordanstrickland1149 9 месяцев назад
He had it coming. And way to go Shoto
@marytijerina9764
@marytijerina9764 9 месяцев назад
Sweet, Sweet Revenge!
9 месяцев назад
merry crisms