Тёмный

​[BANGTAN BOMB] ​'​Anpanman' Special Stage (BTS focus) @​BTS COMEBACK SHOW - BTS (방탄소년단) 

BANGTANTV
Подписаться 79 млн
Просмотров 8 млн
50% 1

BTS Official Homepage bts.ibighit.com
BTS Blog btsblog.ibighit.com
BTS Facebook / bangtan.official

Видеоклипы

Опубликовано:

 

13 июл 2018

Поделиться:

Ссылка:

Скачать:

Готовим ссылку...

Добавить в:

Мой плейлист
Посмотреть позже
Комментарии : 15 тыс.   
@featheanzatty5688
@featheanzatty5688 6 лет назад
Jungkook at the beginning lol so cute 😂
@lolhai3253
@lolhai3253 6 лет назад
Ik TAEKOOOKKK
@era1345
@era1345 6 лет назад
Cute 0:05 2:52 his dance is my favorite♡♡
@aneesah8022
@aneesah8022 6 лет назад
0:06 Jungkook: *vigorously ruffles Tae’s shirt*
@zaccaih
@zaccaih 6 лет назад
Aneesah Ikram I was about to comment that...oh well
@mikasaarmy8964
@mikasaarmy8964 6 лет назад
Aneesah Ikram so cute anpanman
@nikko_o77
@nikko_o77 6 лет назад
ѕαмє ℓσℓ
@xxspacepotatoexx1013
@xxspacepotatoexx1013 6 лет назад
Aneesah Ikram Oh ShAt I tHoUgHt It WaS wInD...
@armeme8101
@armeme8101 6 лет назад
😂😂😂
@vitoriia14
@vitoriia14 3 месяца назад
2024, anyone?
@Saylamebt
@Saylamebt 2 месяца назад
Eu
@I_love_you_613
@I_love_you_613 Месяц назад
💜
@theyoungkorean07
@theyoungkorean07 Месяц назад
Yup
@ilovejimin7
@ilovejimin7 Месяц назад
Me ofc💜
@im_kpop_stan
@im_kpop_stan 26 дней назад
Mee
@lenanana8
@lenanana8 3 года назад
0:28 Jin's jump We need to talk about this more!
@mrdayy6527
@mrdayy6527 2 года назад
Yeahh my boy is soo cool 😎
@neverwalkalonesj5038
@neverwalkalonesj5038 Год назад
Yeah, I love it
@danielaoliveira-dt8gn
@danielaoliveira-dt8gn 3 месяца назад
​@@neverwalkalonesj5038oi
@mominaaasim7867
@mominaaasim7867 6 лет назад
0:05 jungkook's special effects😂😂😂😂I love him so much
@armyin_dahouz6363
@armyin_dahouz6363 6 лет назад
Ice Cream vkook 😌
@armyin_dahouz6363
@armyin_dahouz6363 6 лет назад
Chandra Lukinich same thing lol
@goldensugakookie2987
@goldensugakookie2987 6 лет назад
Jungkook flapping Taehyungs shirt so hard in the beginning is so adorable
@otaku22nyan28
@otaku22nyan28 6 лет назад
How do your comments come up to the top without even any likes and mine always lost in the sea of comments? Curious...
@soyaasam
@soyaasam 6 лет назад
i thought you said fappi-
@goldensugakookie2987
@goldensugakookie2987 6 лет назад
Otaku 22Nyan// really? I didn’t even know that
@xiaoyang7368
@xiaoyang7368 6 лет назад
Golden Sugakookie Do you ship taekook too?
@user-kf8bw2fq2r
@user-kf8bw2fq2r 6 лет назад
😂
@gorgelicious24
@gorgelicious24 3 года назад
omg why is nobody talking about how cute hobi is? he is soooo adorale and looks so happy and lively! aww he is really enjoying this dance. jungkook is so cute on his bit near the end!!!!!
@glaciouscathy6501
@glaciouscathy6501 2 года назад
Gyyygyyuytyttcffchkfhjgvjjhvchjjxgjjgghhgfhjgdghhgfgghjjgfgjjjhgf. Hdyihsthjgdfhggjjhgggghjhhfghhjh❤️❤️❤️❤️❤️❤️❤️❤️❤️💔💔💔👰🏼‍♂️🥳😍🥰😎✌️✌️
@glaciouscathy6501
@glaciouscathy6501 2 года назад
Ddffgggfgffffddddddbbhffdfghhhgfffghjkhgffhjhgdddfgggghjjhfffgghhhgghhhhjkkgfghjhffhjjhgfghjjjgfghjj💔💔💔💔💔💔💔💔💔✌️
@AxelMacopelli
@AxelMacopelli 2 года назад
It hasn't been said enough how impressively Yoongi and Jin played off that very real trip Kings of professionalism 🤴
@danielaoliveira-dt8gn
@danielaoliveira-dt8gn 3 месяца назад
?
@AxelMacopelli
@AxelMacopelli 3 месяца назад
​@danielaoliveira-dt8gn technically a fake trip is a part of the choreography, but Yoongi's ankle crumpled to one side when he accidentally stepped on Jin's foot. They played it off well
@vkookbts8530
@vkookbts8530 6 лет назад
0:05 _ 0:15 JUNGKOOK 😂😂 OMG LAUGH SO HARD 😅😅😅😅😅😅😅😅😅😅😅
@emianasayshi9058
@emianasayshi9058 6 лет назад
Vkook BTS Same lmao 🤣🤣🤣🤣
@jazzymarshlew
@jazzymarshlew 6 лет назад
Vkook BTS SAME 🤣🤣🤣🤣🤣
@wispycloud7184
@wispycloud7184 6 лет назад
Same i woke my mom up (im in trouble lol)
@piepie8976
@piepie8976 6 лет назад
Jungkook's face is so intense while doing it too XD
@livelaughlovehoshi
@livelaughlovehoshi 6 лет назад
Vkook BTS SPECIAL EFFECTS MAN 😂
@haechpop2048
@haechpop2048 6 лет назад
0:07 *_❝ The devil works hard but Jeon Jungkook works harder ❞_*
@mccucrumbs8916
@mccucrumbs8916 6 лет назад
koko's thighs no props needed when jeon jungkook is around😂
@elijahvera6086
@elijahvera6086 6 лет назад
LOL
@suciwarda6939
@suciwarda6939 6 лет назад
ikr 😂
@leilaniaperson1990
@leilaniaperson1990 6 лет назад
koko's thighs lol
@cheonsamanggae9000
@cheonsamanggae9000 6 лет назад
i know right HAHHAHAHA
@hungrylyly
@hungrylyly 3 года назад
0:27 so are we just gonna ignore Jin's cute heel click look how adorable
@tashahaseena1200
@tashahaseena1200 3 года назад
Let see how many people coming in 2021??💜 JUST ME????🤔
@anismolbaby4367
@anismolbaby4367 3 года назад
Me
@cursedcockroachwithcatears3653
@cursedcockroachwithcatears3653 3 года назад
H e l l o
@Cristobels-Green-Boots
@Cristobels-Green-Boots 4 месяца назад
‘24 - & loving it! 🫠
@ame_carballo
@ame_carballo 3 месяца назад
Hola en 2024 😊
@yoonkimin1232
@yoonkimin1232 6 лет назад
*junggoo working so hard doing that fanning thing uwu*
@nana6075
@nana6075 6 лет назад
BTS Lounge 😂😂😂
@squilly7340
@squilly7340 6 лет назад
BTS Lounge LMAOOOO
@kyliemarxen7537
@kyliemarxen7537 6 лет назад
Seriously tho 😂 he was trying so hard
@Hlloyue
@Hlloyue 6 лет назад
BTS Lounge lmao
@gorgeoustaehyung4413
@gorgeoustaehyung4413 6 лет назад
*jungkook moving tae's shirt like his life depends on it 😭*
@collineercia3404
@collineercia3404 6 лет назад
It is kind of funny
@lasprimas1657
@lasprimas1657 6 лет назад
VKOOK
@maddya8278
@maddya8278 6 лет назад
I like your profile picture twilight bright anybody know all the choreography
@maddya8278
@maddya8278 6 лет назад
Auston Matthews naah he probably just likes Jin
@ChauNguyen-dw4sg
@ChauNguyen-dw4sg 6 лет назад
SO *ADORABLE* AND *CUTE* 😭
@aizensvank5981
@aizensvank5981 3 года назад
Anpanman will forever be one of my favorite concerts
@irenemadreembid7384
@irenemadreembid7384 3 года назад
the best performance was anpanman with army on speak yourself tour!
@isabelle1250
@isabelle1250 3 года назад
anyone gonna talk about how professionally yoongi and jin handled the accidental trip? 0:50 edit: thanks for all the likes!!! i’ve noticed people saying that its on purpose but clearly yoongi’s ankle twisted in a weird way, and ofc the fake fall is in the choreo but i dont think yoongi and jin were supposed to physically bump into each other. nonetheless even if it weren’t in the choreo yoongi and jin handled it very professionally.
@Pokefan-qx7iy
@Pokefan-qx7iy 3 года назад
Oh yeah
@carolinekruk9080
@carolinekruk9080 3 года назад
i always assumed it was on purpose lol
@noneofyourbusiness74
@noneofyourbusiness74 3 года назад
It was on purpose
@noneofyourbusiness74
@noneofyourbusiness74 3 года назад
@@carolinekruk9080 it was
@LoveMusicSoul1
@LoveMusicSoul1 3 года назад
None Of your business This definitely seemed like an accident, Yoongi’s ankle turned a weird way. In the dance they’re supposed to fake trip but I don’t think that yoongi was actually supposed to trip like that. They’re just such stars that you don’t even notice the subtle mistakes
@pwangkwang
@pwangkwang 6 лет назад
The face JungKook does when he is behind Tae's sweater 😂😂😂
@user-jl9fg4ny4q
@user-jl9fg4ny4q 6 лет назад
Jin is such a good dancer❤️❤️❤️
@donutsandgamesanime2181
@donutsandgamesanime2181 6 лет назад
Ikr
@raenydayy
@raenydayy 6 лет назад
YAHHHH
@metholi6293
@metholi6293 6 лет назад
لي هيوري اعرف
@chicapau1605
@chicapau1605 6 лет назад
Yes he's 😍
@saumyaa2981
@saumyaa2981 6 лет назад
Someone said: "he dance like a traffic police officer" Me: NAH YOU GOTTA BE KIDDING !!!!!!
@lohorst7948
@lohorst7948 3 года назад
Lol Jin and Jimin’s outfits are super similar so for a moment I was like “damn Jin is really graceful here!” But for real he did great in this!
@gmi3204
@gmi3204 4 года назад
Jhope is too adorable^•^
@to-tr5eo
@to-tr5eo 6 лет назад
0:05 *The best special effects, eVER.*
@soliechamp
@soliechamp 6 лет назад
πto MEGA AGREE
@allenciafernandes
@allenciafernandes 6 лет назад
πto 🙊ikr
@taehyungslollipophair1311
@taehyungslollipophair1311 6 лет назад
I swear
@ResaChiic
@ResaChiic 6 лет назад
i cant believe they specifically zoomed in on the side *just* for that
@12myea
@12myea 6 лет назад
10/10 would hire for special effects
@nana-mk5pi
@nana-mk5pi 6 лет назад
yoongi: i can be your hero me: *remembers run! bts ep.24*
@sulfisulfiker1518
@sulfisulfiker1518 6 лет назад
I like memes #BTSISCOMINGBACK ❤❤❤❤❤
@coleenhernando1604
@coleenhernando1604 6 лет назад
hahhahah best comment ever. neva 4get that episode
@simra6128
@simra6128 6 лет назад
Omg ! How can you remember the episode number ? Memory skills on point 😏
@NoviRV
@NoviRV 6 лет назад
I like memes ahahahaa.. At least he have that fist mode 😂😂😂
@hoshicloud
@hoshicloud 6 лет назад
best comment so far lololol
@minotofu
@minotofu 3 года назад
Jungkook flapping Taehyung’s shirt is gonna be iconic forever
@sayedaspriha6043
@sayedaspriha6043 3 года назад
Today I realized closely that J-Hope's legs are soo smooth when they dance J-Hope's legs are.made for dance............and hi- Hip t-t-thr-ust..... I swear I was innocent until I joined this fandom😭
@Polsityxnaj
@Polsityxnaj 6 лет назад
Jungkook at the beginning i can't😂😂😂
@joannachoun2369
@joannachoun2369 6 лет назад
Huemang No.1 so funny
@chandlerbing1669
@chandlerbing1669 6 лет назад
YESSS HAHA
@blackisblack5793
@blackisblack5793 6 лет назад
JIN DANCE IS THE BEST NOW
@yaezia2258
@yaezia2258 6 лет назад
A.R.M. Y it’s true😏
@denisew.130
@denisew.130 6 лет назад
A.R.M. Y Did you see him jumping???? Almost as flawless as Jungkook ♡
@zillaearl6031
@zillaearl6031 6 лет назад
He has improved a lot
@loveyourself4703
@loveyourself4703 6 лет назад
A.R.M. Y yup. 😊😊
@rachaelmin4234
@rachaelmin4234 6 лет назад
decentia a ikr,I couldn't take my eyes off of him, he has improved alot 😊😊😊😊😊😊😊😊
@bxnnyjeon.97
@bxnnyjeon.97 Год назад
Jungkook flapping taehyung’s shirt to help him like a superhero is the cutest thing ever. He’s just the cutest 💜🥰
@maribelramos9517
@maribelramos9517 Год назад
Yesssss!!!
@ronniepeony
@ronniepeony Год назад
My absolute favorite BTS song and version of it 🤩❤️
@lady335fantage
@lady335fantage 6 лет назад
Shoutout to BigHit’s cameraman for showing Jungkook flapping Tae’s hoodie 🙌
@abbie5902
@abbie5902 6 лет назад
Yesss XD
@haniaf6708
@haniaf6708 6 лет назад
YES YES
@ang1296
@ang1296 6 лет назад
i love how they show jungkook doing the little effect in the beginning uwu
@avanijoshi555
@avanijoshi555 6 лет назад
I WAS WONDERING HOW TAE GOT HIS FLYING EFFECT WITH THERE BEING NO FANS AROUND WHATSOEVER! but lol it was kookie all along
@era1345
@era1345 6 лет назад
정국이 열일하네🤣🤣🤣
@Masa.49
@Masa.49 Год назад
Can we just talk about 2:49-3:29 IT WAS AMAZING they are so talented ❤️❤️
@mursalsaid5448
@mursalsaid5448 3 года назад
My little brother (4 yo) loves jhope and then he saw jhope looking like a fireman he was sooo joyful because his bias looked his heroes
@infinitybts1830
@infinitybts1830 6 лет назад
0:06 such an effort jungkook..😂😂😂
@niyatimurarka766
@niyatimurarka766 4 года назад
Hahaha...he is so cute lol
@user-gf5br9ug3k
@user-gf5br9ug3k 3 года назад
💜 ⏩⏩
@snyaaaa.12
@snyaaaa.12 3 года назад
Before I watched this video I watched the other one and poor me I thought there would be some type of fan or something but it was jungkook 🤣🤣🤣🤣
@harukavideomaker429
@harukavideomaker429 3 года назад
The funniest and cutest i saw it for today my favorit video for today 🤣🥺💖
@mochiaki_
@mochiaki_ 4 года назад
*If it wasn't for this video, we wouldn't know that it was Jungkook who's doing that to Tae's sweater lmao*
@nadiacallista1749
@nadiacallista1749 4 года назад
Pdlslslsls A aaalaa Aalaa.aasksksakaksxpamwswmapampslalpalaappaaalalakalskskakamakq spamalamoqkawpmapwkpqpqqpqpqqlalaalalaalaa Alskswkkwwklwkwkakkakwsmskmskawkakdkdkfjhgakz,mxmxmcmccmcv jd,slka,sla,a,a,a,alala.ala.alaa,aa,alaa Alalwlawlallsksls,lllelwllwlwlwwl,wpw,wlwlwwlwllwlwwlwleldld,lewlwlwl,s w,s ws,sls,slwllw Q
@wurtn
@wurtn 3 года назад
@@nadiacallista1749 Aree you ok... u need a doctor?
@ShwetaSingh-yy1lj
@ShwetaSingh-yy1lj 3 года назад
@@wurtn Savage 😂😂
@compilations8166
@compilations8166 3 года назад
Samee
@nazneenaslam6003
@nazneenaslam6003 3 года назад
I knew it was jk from the beginning, when the performance started I couldn't see him but I saw tae's shirt flapping so I knew it was Jungkook flapping it.
@gwendolyncormier9026
@gwendolyncormier9026 3 месяца назад
BTS is in the military, but we see them whenever we want online.
@eedhabhardwaj4893
@eedhabhardwaj4893 3 года назад
This 7 men will forever be my anpanman I swear borahae bts💜
@TheJiaKei
@TheJiaKei 6 лет назад
*The amount of details Hoseok put into his dance moves... you can clearly see the difference*
@mariasantillan2237
@mariasantillan2237 6 лет назад
0:29 Jin and Jungkook wowwwww, my boys kill it 🔥🔥
@maneshchoudhary3125
@maneshchoudhary3125 3 года назад
Jungkook flapping Tae's shirt in beginning is too adorable. I PURPLE THEM ALL !! 💜💜
@hobisspritecan9933
@hobisspritecan9933 3 года назад
Is nobody talking about j-hopes outfit? I love it 🤣
@erikagomes5445
@erikagomes5445 6 лет назад
1:49 OMG JUNGKOOK ARE YOU OKAY 😱IT SCARED ME 😂💖 WHO TOO ?😅LOL
@anddna6222
@anddna6222 6 лет назад
Erika Gomes because of your comment I repeat that part several time..
@omeletrashomeletandjuliegg983
@omeletrashomeletandjuliegg983 6 лет назад
OMG 😲
@omeletrashomeletandjuliegg983
@omeletrashomeletandjuliegg983 6 лет назад
It scared me too
@Dani_727
@Dani_727 6 лет назад
Jungkook moving tae's shirt in the beginning is so adorable😭❤
@yiu7834
@yiu7834 6 лет назад
kookieluver 101 you literally copied the comment below you
@heku899
@heku899 6 лет назад
xPsychoNekox :3 XD
@sayyidhaidir7770
@sayyidhaidir7770 5 лет назад
kookieluver 101
@kankykabrera1370
@kankykabrera1370 5 лет назад
HOLA COMOESTAN
@kankykabrera1370
@kankykabrera1370 5 лет назад
SON LINDO Y GRACIOSO
@anzishali7037
@anzishali7037 3 месяца назад
Anyone in 2024 ❤ i miss them 😢
@RebecaHuzur
@RebecaHuzur 3 года назад
I love hobi's vibe, my precious
@howdyfolks8443
@howdyfolks8443 6 лет назад
Jin: What do you call a hero that makes puns? BTS: hyung- Jin: *AnPUNman* *windshield wiper laugh* BTS: just stop pls
@Botwhile
@Botwhile 4 года назад
nice one 😂😂😂
@samyukthas8186
@samyukthas8186 4 года назад
Stob it!
@namu7868
@namu7868 4 года назад
Noduduwud
@jiminsdimple947
@jiminsdimple947 4 года назад
I Love BTS 3000 **only jimin dies of laughter**
@ashleyyy4286
@ashleyyy4286 4 года назад
zxmphy gorl..
@valeriacarazamartinez8787
@valeriacarazamartinez8787 6 лет назад
*0:50** Yoongi and Jin look at their feet...that was super professional,everything looked so natural on stage*
@blarmy827
@blarmy827 10 месяцев назад
Curly koo absolutely dominated this stage and choreo!!! His powerful dancing and smooth transitions are insane… even in the beginning he has those smooth parts with tae and joon and then tae goes away and JK spins backwards drops down to his knees and then has to do a high leap feet kick from the ground… that’s a difficult sequence and he handles it with ease.
@user-xp9tm7xf4b
@user-xp9tm7xf4b Год назад
このアンパンマンを今見ると…素直に泣けちゃいます⤴︎⤴︎⤴︎⤴︎ 皆のヒーロー「BTS」いつまでも、みんなのヒーローでいてください。 最強最高のヒーローでなくていいんです。 身近なやさしい勇気をくれるアンパンマンで!! そろそろ、BTSのアンパンの欠片がほしいです💗
@lilwheat6231
@lilwheat6231 6 лет назад
Jin always kills 2:54
@_.itx_lily7._917
@_.itx_lily7._917 2 года назад
0:40 Suga And Jin Handle It So Well, I thought It Was On Purpose 0:29 Jin And Jk Jump Was Awesome 2:12 Jimin Voice ufff And 0:12 V Voice Saying Anpanman Is Appreciable 0:06 Jk Efforts Are Adorable Whole Song Is Masterpiece 💜
@danielaoliveira-dt8gn
@danielaoliveira-dt8gn 3 месяца назад
não é 0:53 eu tenho quê corrigir o minutos aqui em outro video tb do bts aqui no canal oficial para os outros fãs vê tb 😂😂 KKK aff foi mal kkk 😂😂😂
@Jenniegupta7321
@Jenniegupta7321 19 дней назад
I am watching this video in 2024 . ❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤
@scarlethsoler.8231
@scarlethsoler.8231 6 лет назад
-- *i'm dead this is the cutest thing in the world*
@somlvsfk
@somlvsfk 6 лет назад
Dissociate. Chan No si la que habla dos idiomas
@btsa.r.m.ylittlemixmixer4233
@btsa.r.m.ylittlemixmixer4233 6 лет назад
Alisson Pamela Avila 😂😂😂😂😂 dijo que se murió porque esto es la cosa más tierna que a visto en su vida
@cursedcockroachwithcatears3653
@cursedcockroachwithcatears3653 3 года назад
Ikr
@nope5579
@nope5579 6 лет назад
Finally, we can see Seokjins majestic jump!
@bangtanxdea3129
@bangtanxdea3129 6 лет назад
lol nope ikr! I'm crying 😭
@aleeyashah1015
@aleeyashah1015 6 лет назад
lol nope YAAASSS
@mewtwo6784
@mewtwo6784 3 года назад
Yoongi's part is actually my favorite part in this song especially at 0:39 💙
@xim3gix990
@xim3gix990 3 года назад
1. Taes “waiting for ya Anpanman” (also, Tae overall) 😍 2. The swag on JK! His clothes, his voice! 3. How Suga plays off tripping on Jins shoe (0:49) so well! He also nailed the dance for not being part of the “dance line” 4. Jimins growl. Jimins voice! He also looks so cute throughout this whole video 5. JHope is so loose in this dance! He owns it (they all do but he stands out) 6. Jin is rocking that black and orange so well! And his voice is amazing. He also nailed the dance (same as Suga) 7. RM leadership in his rap at 1:52. How the music quietens down, *salute* RM! Also rocking the full orange! He also nailed the dance (same as Suga) Overall this video is amazing! The visuals between their individual styles plus the staging in the background 😍 I love this song so much!
@nuriarodriguez8338
@nuriarodriguez8338 6 лет назад
1:51 jungkook literally threw himself on the floor
@1pikica2
@1pikica2 6 лет назад
Nuria Rodriguez No wonder he's got so many bruises. 😁
@user-zk4dy5he2d
@user-zk4dy5he2d 6 лет назад
LMAOOOO I DIDN'T NOTICE THAT
@user-fu9pb4ev6w
@user-fu9pb4ev6w 6 лет назад
Nuria Rodriguez The way he fell tho😂
@youdoyou9735
@youdoyou9735 6 лет назад
oh my GOD the use of the word "literally" here is real.
@plush3106
@plush3106 6 лет назад
You Do You literally so rare right? Lmao
@ashmitanandy
@ashmitanandy 6 лет назад
Every time Park Jimin smiled during this performance, my lifespan increased by 2 years.
@VSRides
@VSRides 6 лет назад
Ashmita Nandy hahahaha
@nat-ep9vm
@nat-ep9vm 6 лет назад
Welp I guess we're immortal now :D
@ashmitanandy
@ashmitanandy 6 лет назад
• Natalie • The miraculous medical benefits of Park Jimin! 😂
@renn0913
@renn0913 6 лет назад
Ashmita Nandy lol xD
@nya5629
@nya5629 6 лет назад
yoo, whenever he smiled, my lifespan decreased to the point where now i'm fuckING dEAD. hE'S SO AMAZINGGGSGJDhgkfdsgh
@mjl17
@mjl17 2 года назад
i love how i can focus on jin the whole performance bc on mnet’s version i couldnt 🥲 he is an amazing dancer so cute and fun to see
@sandrasaad7586
@sandrasaad7586 3 года назад
I can't stop watching this song, actually i can't stop watching them lol
@marieekellyyy
@marieekellyyy 6 лет назад
Jungkook doing the special effects thingy for Taehyung 😂😂😍😍👌👌💜💜💜💜
@onceyoujiminucantjimout7341
@onceyoujiminucantjimout7341 6 лет назад
0:08 jungkook indeed the new generation anpanman 😂 the effort 👍 uwu
@hahaha-jv1sh
@hahaha-jv1sh 6 лет назад
😂😂😂
@azimahsahlan7744
@azimahsahlan7744 6 лет назад
Once u Jimin,u can't Jimout lol😂😂😂
@endangwahyuni2876
@endangwahyuni2876 6 лет назад
Once u Jimin,u can't Jimout :*/😂😂😂😂😂😂
@KyraxSKZ
@KyraxSKZ 6 лет назад
But did you even look at his face😍😂😂
@user-kj6id2hn6x
@user-kj6id2hn6x 6 лет назад
Once u Jimin,u can't Jimout , First off, your name 😂😂😍 and TAEKOOK ❤⚠
@Star-yw8od
@Star-yw8od 3 года назад
but can we talk about ARMY for a second? you could hear BTS singing really clearly like they were in a movie because of how quiet and respectful ARMY were!
@RZA011.
@RZA011. 18 дней назад
Year 2024 and yes it's still my favorite BTS song💜🔥
@hm.99
@hm.99 6 лет назад
I'm the only one who think, that Yoongi can dance better ? I'm so proud of him 👏🏻
@jiminhasjamsanditstrue5394
@jiminhasjamsanditstrue5394 6 лет назад
Suga Saprin they all dance good 😑
@HUARIEE
@HUARIEE 6 лет назад
JIMIN HAS JAMS AND ITS TRUE i think she meant That he has improved
@jiminhasjamsanditstrue5394
@jiminhasjamsanditstrue5394 6 лет назад
Rice fields yoongi was a god in dancing already
@vtecgarcia1956
@vtecgarcia1956 6 лет назад
Suga Saprin not better cuz that's rude to the other members but dances awesome
@tania2387
@tania2387 6 лет назад
yoongi could always dance perfect he's just so underrated in the dance category
@nikkiboo350
@nikkiboo350 6 лет назад
JINS DANCING DURING JUNGKOOKS DANCE PART OMG YESSSS SO AMAZING
@kalaranibhaskar4534
@kalaranibhaskar4534 Год назад
Yoongi and jhope stood out in this performance …😍😍
@maribelramos9517
@maribelramos9517 Год назад
So perfect, wonderful, talented performance!!! I adore them!!!!BTS forever!!!💜
@peachsoup3695
@peachsoup3695 6 лет назад
2:54 jin at it agAIN GET IT MY BOIII MAIN DANCERRRRRR
@rav3ngarde905
@rav3ngarde905 6 лет назад
What I think happened: Big hit: We need someone to hold a fan behind V JK: I can do it Big hit: You sure? How are you gonna get rid of the fan? JK: Oh I got a better idea... *Flaps V's outfit like his life depends on it*
@teresaramos4054
@teresaramos4054 6 лет назад
Rav3n Garde YESSS😂
@camilareyes8930
@camilareyes8930 6 лет назад
Rav3n Garde no entendí pero like :v
@jakijakizikra945
@jakijakizikra945 2 года назад
0:35 suga voice 🔥😎
@ashaomar7831
@ashaomar7831 3 года назад
This song can always makes my day. ❤️
@lovelyangel1964
@lovelyangel1964 6 лет назад
Since no one states the obvious. The Hyung line: Jin, Hobi, Suga and RM gave this song life.
@miranpadilla3395
@miranpadilla3395 6 лет назад
*Wow, Jin's dance is so good :0♥*
@iamarmyot7
@iamarmyot7 5 месяцев назад
La canción "Anpanman" de BTS trata sobre ser un héroe en la vida cotidiana, y cómo cualquiera puede ser un héroe independientemente de sus habilidades. La letra utiliza al personaje Anpanman, un popular personaje de dibujos animados japonés que es conocido por sacrificarse para ayudar a los demás, como una metáfora para ser un héroe. El primer verso habla sobre el deseo de ser un superhéroe, pero darse cuenta de que todas las cosas tangibles que uno tiene que ofrecer son tan simples como un Anpan, un pan dulce relleno de pasta de frijol rojo. La canción luego pasa al coro donde cantan sobre enfrentar desafíos y experimentar dolor, pero seguir perseverando y haciendo su mejor esfuerzo. El puente es una afirmación del compromiso del cantante de ser un héroe, incluso si cometen errores, y anima a otros a confiar y creer en ellos. En general, la canción enfatiza la idea de que cualquiera puede ser un héroe si tiene la voluntad de ayudar a los demás y hacer lo mejor que pueda, incluso si no tienen habilidades extraordinarias. Es un mensaje de esperanza y aliento para enfrentar los desafíos de la vida cotidiana con valentía y resiliencia.
@danielaoliveira-dt8gn
@danielaoliveira-dt8gn 3 месяца назад
Sério
@christianandreipitao5937
@christianandreipitao5937 2 месяца назад
Who is watching in 2024?
@jn5y
@jn5y 6 лет назад
1:51 you're not a stuntman jungkook..
@jaejae5443
@jaejae5443 6 лет назад
Jungkookie so cutee 💣💣💣 😘😘😘 0:05 😂😂 V's t-shirt like superman😂
@nazwaathiatulf5068
@nazwaathiatulf5068 6 лет назад
Fauziiah4ver lol haha
@muhammadrismawan7641
@muhammadrismawan7641 6 лет назад
Fauziiah4ver taehyungiee so cutee
@kooora_ana
@kooora_ana 23 дня назад
0:36 Their sound is beautiful
@josephgonzales5781
@josephgonzales5781 3 года назад
Am I the only one here who thinks Anpanman would be an awesome superhero. Like he'd be the Batman of Korea
@dawgucci5793
@dawgucci5793 6 лет назад
0:05 Mr Jeon effects Jungkook activated
@lucianafernandez6261
@lucianafernandez6261 6 лет назад
JIN Y NAHIARA bTS💋💘❤️💓💕💖👄💜💛💝💟❣️💗💞💌
@lucianafernandez6261
@lucianafernandez6261 6 лет назад
💛💟💌💙💌💗💌💟❣️❣️❣️💙❣️💗💚💛💙💚💟💚💜💛💜💝💟💞💗❣️💚💛💌💜💜💗💙
@jungkooksbeautifulvoice7326
@jungkooksbeautifulvoice7326 6 лет назад
JUNGKOOK IS SO CUTE OMG
@nataliassi_
@nataliassi_ 6 лет назад
Yesssss
@era1345
@era1345 6 лет назад
0:05 1:50 2:52 cute and fuuny😍😍😍
@baekhyunsdaughter-in-law1861
@baekhyunsdaughter-in-law1861 6 лет назад
I saw you everywhere 👏👏
@thaomydo84
@thaomydo84 6 лет назад
Baekhyun, Seulgi & Jungkook phi Kon pppppppppppp0pppppppp
@jeoncindy2601
@jeoncindy2601 6 лет назад
Baekhyun, Seulgi & Jungkook i agree with u
@seven-heaven0613
@seven-heaven0613 2 года назад
와 입덕한지 얼마안되서 몇개월동안 맨날 얘네 노래만 듣는데 들어도 들어도 다 새로운게 계속나옴ㅋㅋㅋ무슨 9년차아이돌이 20년된 신화보다 많은듯..어휴..근데 또 다좋아요ㅜㅜ
@ammarahmad6422
@ammarahmad6422 Год назад
OMG SUGA IS SO AMAZING WHEN HE SINGS👍👍👍😂
@kimjionysus8136
@kimjionysus8136 6 лет назад
Jin dancing is no joke tbh
@taehyungsnosefreckle5525
@taehyungsnosefreckle5525 6 лет назад
I couldn’t keep my eyes off of Jin. His dancing has improved so much!
@reyn1288
@reyn1288 6 лет назад
Exactly :)))))
@kirandey1744
@kirandey1744 3 года назад
I love this song and especially this performance i keep rewatching it 💜 they all look so cute and happy in this 💜
@thvvzzz
@thvvzzz 3 года назад
Suga cute💜💙🖤👑
@mirandarv17
@mirandarv17 6 лет назад
Jin killed this dance he was so good
@OUR_DAYS_ARE_GOLDEN
@OUR_DAYS_ARE_GOLDEN 6 лет назад
Jungkook is such a cute, and an angel. When they showed him trying to be like Anpanman I'm like he is Anpanman 😂😂😂😍😍
@saylars8938
@saylars8938 6 лет назад
He wasn't fanning Tae, he was trying to make it look like Tae was flying like _superman_ But yeah, JK is a cutie.
@OUR_DAYS_ARE_GOLDEN
@OUR_DAYS_ARE_GOLDEN 6 лет назад
XO XO oh thank you Army for telling. My mistake lol😂😂😖😖
@mrcraft4583
@mrcraft4583 2 года назад
V's voice, I just feel like I am in heaven😊😊😊😊😊
@kiellygooden761
@kiellygooden761 3 года назад
Teahyung:Jungkook stoopppp Jungkook flipping teahyung shirt:🤗😏🙃🙂🙃🙂🙃🙂🙃🙂🙃🙂☺️☺️☺️☺️☺️☺️☺️☺️☺️☺️☺️😉😌
@user-md3ic7bj9k
@user-md3ic7bj9k 6 лет назад
DANG JIN’S DANCE JUST KEEPS GETTING BETTER
@jinsface9875
@jinsface9875 6 лет назад
Jin has grown so muchhhh.
@nafisarahmansadika1971
@nafisarahmansadika1971 3 года назад
Taehyung voice was so adorable when tea was saying Anpanman ❤❤❤❤
@sydneypot7074
@sydneypot7074 2 года назад
Namjoon acting like Anpanman was so freaking adorable.. and the way he was surprised when Jimin got up and started dancing.. it was so cute
@raishps1833
@raishps1833 6 лет назад
SO THAT'S WHAT IT LOOKS LIKE I always wanted to see Jungkook's shaking XD
@Luna_Moon
@Luna_Moon 6 лет назад
Raish PS worst pun ever😂❤ but still funny though 😂😂
@choileepark8974
@choileepark8974 6 лет назад
My ANPANMAN IS BTS😄😄😃😃😊☺
@ysa_kim4143
@ysa_kim4143 6 лет назад
Choi LeePark 😂😂😂😂😂
@choileepark8974
@choileepark8974 6 лет назад
ŲMĄ ÇRY Ą.R.M.Y ;3 .. Why😅😅
@abigaildelacruz8025
@abigaildelacruz8025 Год назад
No se como pueden decir que Jin no baila, lo hace increíble ❤
@zavagirlz
@zavagirlz 3 года назад
Taehyung is so freakin' adorable. Luv this. (this version way better than the actual video!)
@aiai7410
@aiai7410 6 лет назад
Jin is so cute and handsome as usual)
Далее
Спецэффекты в Симс 4
00:36
Просмотров 279 тыс.
[BTS] JUMP Stage Mix (Eng Lyric Video)
3:59
Просмотров 27 млн
BTS's favorite is imitating each other
10:09
Просмотров 25 млн
MENDA - Maybe (Original Mix)
6:49
Просмотров 184 тыс.
Doston Ergashev - Kambag'alga (Official Music Video)
5:32
OG Buda - Сделай Мне Приятно Щас
2:24