Тёмный

Aur Kya | Phir Bhi Dil Hai Hindustani | Full Song | Shah Rukh Khan | Juhi Chawla 

Red Chillies Entertainment
Подписаться 13 млн
Просмотров 28 млн
50% 1

Watch 'Aur Kya' full song from 'Phir Bhi Dil Hai Hindustani' featuring Shah Rukh Khan & Juhi Chawla in the lead roles. 'Aur Kya' is sung by Alka Yagnik & Abhijeet Bhattacharya #phirbhidilhaihindustani #juhichawla #azizmirza #aurkya #srksongs
Song: Aur Kya
Film: Phir Bhi Dil Hai Hindustani
Singer: Alka Yagnik & Abhijeet Bhattacharya
Lyrics: Javed Akhtar
Music Composer: Jatin - Lalit
For more updates on Phir Bhi Dil Hai Hindustani, click on the links below:
/ redchilliesent
/ dilwalethefilm
/ redchilliesent

Опубликовано:

 

8 сен 2024

Поделиться:

Ссылка:

Скачать:

Готовим ссылку...

Добавить в:

Мой плейлист
Посмотреть позже
Комментарии : 3,3 тыс.   
@rehanamili4717
@rehanamili4717 3 года назад
SRK & Juhi chemistry is really underrated 💔 I found them so cute & attractive together!! ❤️
@HassanAli-yr8jv
@HassanAli-yr8jv 3 года назад
I love srk juhi far more than Srkajol
@rehanamili4717
@rehanamili4717 3 года назад
@@HassanAli-yr8jv completely agreed!
@status1186
@status1186 3 года назад
मुझे परेशान ना करने वाली सब एक्टर्स महत्व पूर्ण है
@dibakarchoudhury6835
@dibakarchoudhury6835 3 года назад
सही है
@daijiro4918
@daijiro4918 3 года назад
@@HassanAli-yr8jv actually its magic of srk See him in ladki badi anjani with kajol in k2h2 Or are re are with madhuri in dil to pagal h
@tushargurav4550
@tushargurav4550 3 года назад
Bachpan me pohoch gaya mein . ......... SRK with Juhi all time best couple as per acting skill , looks and chemistry which they delivered in every film
@kapiloryou
@kapiloryou 3 года назад
People often say about AR Rehman but I will always that Jatin Lalit are the most soulful music director truly legend 🙌
@sushilpurohit3080
@sushilpurohit3080 2 года назад
Absoulty brother. That duo of jatin ji lalit ji is unmatchable. 💓💓💓
@RakeshVerma-my6rl
@RakeshVerma-my6rl 2 года назад
I m totally agree with you bro
@aniketroy7623
@aniketroy7623 2 года назад
Ekdum sahi kaha. Mai humesha yehi keheta hu toh sab bura mante hai. But AR Rehman ka music aisa kuch khas hai nahi. Yes thoravdiffrnt lagta hai.bura nahi hai but aisa bhi kuch out of thr box nahi hai
@abdulraheemalmujaddedi5696
@abdulraheemalmujaddedi5696 2 года назад
Ssss,ssssssks ddwiu
@jairajpuri2165
@jairajpuri2165 2 года назад
You forgot t about Nadeem shravan, they brought back melodious music trend in 90s..
@sweetlibra1302
@sweetlibra1302 4 года назад
I literally searched for this song to just watch Juhi Chawla....she is pure beauty...💕 flashback of childhood😓
@CW-rx2js
@CW-rx2js 2 года назад
Me too! And a good actress too
@user-le6fe8vl9l
@user-le6fe8vl9l Год назад
I agree ❤
@AnandiShankar
@AnandiShankar Год назад
Me too I am a great fan of hers… she is THE BEST ❤️😢she is not doing anymore films .
@IntruderAbhi
@IntruderAbhi 3 года назад
Every one talks about SRK Kajol chemistry but SRK and Juhi chemistry also at that level.
@arpitapanigrahy3551
@arpitapanigrahy3551 3 года назад
But juhi aisa legend hai koi bat world ko dikhana nahi chahata hai srk juhi best friend and couple
@JS-yj4cx
@JS-yj4cx Год назад
Right 👍
@kimberlychako7269
@kimberlychako7269 Год назад
Better
@kavik8376
@kavik8376 7 месяцев назад
​@@JS-yj4cx1apaaqa😊q😊@@aa paaqqaqpp😊😊pp😊alap😊
@srinivassajjan954
@srinivassajjan954 6 месяцев назад
I don't think so😂
@CW-rx2js
@CW-rx2js Год назад
Juhi Chawla is ethereal. Just another level of beauty 😍 2:37 nobody can match her among today's fake actresses
@amu_1911
@amu_1911 3 года назад
Srk gives me goosebumps whenever I see him smile..he has such a magnetic persona
@haroonkapoor8233
@haroonkapoor8233 3 года назад
srk is good looking right? I mean his face??
@bigthinker0
@bigthinker0 3 года назад
@@haroonkapoor8233 ofcourse ❤️❤️❤️😘
@haroonkapoor8233
@haroonkapoor8233 3 года назад
@@bigthinker0 what do you find in srks face good looking tell me honestly??
@haroonkapoor8233
@haroonkapoor8233 3 года назад
@@bigthinker0 which parts of his face??
@bigthinker0
@bigthinker0 3 года назад
@@haroonkapoor8233 smile ❤️❤️❤️😘😘
@amanvishwakarma5349
@amanvishwakarma5349 3 года назад
I M Leaving This Comment In Hope That Whenever Someone Like This...I Will Be Reminded Of This Masterpiece❤
@rekhasilta4314
@rekhasilta4314 3 года назад
Srk jd juhi onscreen cutest funny nd luvabele couple in bollywood......no 1 jodi.....inke samne sari jodiyan fail
@majalanmajalan8664
@majalanmajalan8664 3 месяца назад
🤍Assam 🇮🇳
@simonswamy688
@simonswamy688 3 года назад
All the comments are about abhijeet Shah Rukh Khan and juhi chawla but let's give credit to Jatin Lalit for an amazing composition what melody man it gives me goosebumps
@anushahegde9774
@anushahegde9774 4 года назад
Abhijeet Bhattacharya has a heavenly magical voice.He has the capacity to make a dull song interesting. Shahrukh Khan and Juhi Chawla make a good onscreen pair. Love this song😍😍🎶🎶
@yourblackstar19
@yourblackstar19 3 года назад
He has a trashy personality so that kind of ruins it for me.. I try to ignore it while enjoying the song
@prasantapandaprasanta8824
@prasantapandaprasanta8824 3 года назад
@@yourblackstar19 Hume matter nahi karta... Kyunki abhijeet da k hum fan Hai... Sab ka apna apna najariya hota Hai.. Tum sale log wohi ho jo india ko intollrent bolte Hai aur tum unko support karte ho
@maxamudsaciidbile9273
@maxamudsaciidbile9273 3 года назад
@Ankita Srivastava.you.hcobpyyh. 9 Humph B Hp Mn Hope N . 0j. ..9hpb.pnop.p B.9blhP ..l on.mlj pypp00.g9l.l.nn.. .nlloopp.9bbblyhpp9j00mpm0pm.mhm99n.jpjj.9bnp ppob9pllopohl 9.ho9pph.9. Lljpo..9hhhhj h9b..php.9g.bhllNhNi 9 Gn9lopph H onMllmpo
@maxamudsaciidbile9273
@maxamudsaciidbile9273 3 года назад
@Ankita Srivastava.you.hcobpyyh. 9 Humph B Hp Mn Hope N . 0j. ..9hpb.pnop.p B.9blhP ..l on.mlj pypp00.g9l.l.nn.. .nlloopp.9bbblyhpp9j00mpm0pm.mhm99n.jpjj.9bnp ppob9pllopohl 9.ho9pph.9. Lljpo..9hhhhj h9b..php.9g.bhllNhNi 9 Gn9lopph H onMllm
@nripendrachakma2921
@nripendrachakma2921 3 года назад
yr
@adityamahalle421
@adityamahalle421 Год назад
Who Thinks that SRK-Juhie better pair than SRK- Kajol?
@tiktokshorts6550
@tiktokshorts6550 6 месяцев назад
They are just funnier
@AM1993.
@AM1993. 6 месяцев назад
True to the word! Would love to see the jodis comeback with the same Director Aziz Mirza ji and Music Composers Jatin-Lalit !❤
@RelationshipPro2024
@RelationshipPro2024 6 месяцев назад
Me
@AM1993.
@AM1993. 6 месяцев назад
And also With Abhijeet , Udit ji and Sanu Da as singers !! 🥰
@subhraghosh8330
@subhraghosh8330 6 месяцев назад
Me
@game_changer991
@game_changer991 3 года назад
Voice of Abhijeet... Juhi and Shahrukh... Damn.. It's great... Our childhood memories....!.. Always will be there.....
@prernasinha1536
@prernasinha1536 3 года назад
You forgot Alka Yagnik!!
@game_changer991
@game_changer991 3 года назад
@@prernasinha1536 Oh yes..Alka ji ...Of course!!!! How could I forgot to mention her...
@GauravSharma-zk3sz
@GauravSharma-zk3sz 3 года назад
One of the most romantic song from 90's era. The melody is so calm and soothing that can't be explained though words. Just feel the magic.
@kamakshijolly4156
@kamakshijolly4156 3 года назад
Year 2000
@rahulpalit7250
@rahulpalit7250 3 года назад
ģģg
@cherrymathur3504
@cherrymathur3504 3 года назад
Wmkwpwkqmoikkkekpkqoklk pop see ekwkwkwjepwwkwlwmejrowjpwkeekpwkwmewpmemwwmemekemel ekwkwkwjepwwkwlwmejrowjpwkeekpwkwmewpmemwwmemekemel jk w km Keke mk pl mk wlkwllwkwpwkpkqppkewkeikwkwmwlkwwojwlkkeke hi wiejekoenwne
@veekkasdeshmukkh2797
@veekkasdeshmukkh2797 3 года назад
Excellent romantic song. So nice to hear. Abhijeet is best in singing romantic songs.
@junaidmalana7874
@junaidmalana7874 3 года назад
yess most romantic Song only love srk and juhi
@paulinedoorgen7242
@paulinedoorgen7242 2 года назад
Gosh never gets weary looking at video clips of Juhi and Shah Rukh.. this pair is so mesmerizing and their theme work says it all.. how I wish to see a reunion of them in a film once again.. Shah Rukh and Juhi makes the best jodi couple on Indian screen.
@JS-yj4cx
@JS-yj4cx Год назад
Right 👍
@kimberlychako7269
@kimberlychako7269 Год назад
Agree
@jyotitawde2443
@jyotitawde2443 9 месяцев назад
Right
@ahmadyasin8674
@ahmadyasin8674 3 года назад
My dream reunion Sirf ek gaane ke liye, bas ek SRK-Juhi Jatin-Lalit sir Abhijit sir-Alka Ji
@SachinS-sf2vm
@SachinS-sf2vm 3 года назад
Same ❤️
@ajaydhayfule1673
@ajaydhayfule1673 3 года назад
Repeat after me : SRK and Abhijeet's songs are the best thing has happened in hindi music industry 🖤
@tapiyafication
@tapiyafication 3 года назад
Yessss absolutely
@hrishisalunke3627
@hrishisalunke3627 3 года назад
After this... Emraan n himesh duo😎
@ajaydhayfule1673
@ajaydhayfule1673 3 года назад
@@hrishisalunke3627 Emraan and KK too ❤️
@fareedathahir
@fareedathahir 3 года назад
Is SRK ears sri Lankan foods
@fareedathahir
@fareedathahir 3 года назад
Does he eats red bananas
@riyadhrafique8377
@riyadhrafique8377 2 года назад
Shah Rukh Khan & Juhi Chawla in their prime!!! This was the time when they did Yes Boss (1997) & Duplicate (1998) along with Phir Bhi Dil Hai Hindustani (1999).
@mohibquadri4053
@mohibquadri4053 2 года назад
Raju ban gya gentleman & One two ka four also..
@CW-rx2js
@CW-rx2js 2 года назад
@@mohibquadri4053 yeah but Raju BGG was in the early 90s
@jiminncimjinhyungiloveyoui678
@jiminncimjinhyungiloveyoui678 2 года назад
kalian suka gak lagu ini
@user-fk8md4jn3i
@user-fk8md4jn3i 4 года назад
The charm of srk till date is unmatchable
@haroonkapoor8233
@haroonkapoor8233 3 года назад
srk is good looking right??
@Fitness-z2q
@Fitness-z2q 4 года назад
SRK is a king of Romance.... absolutely no one can take his place
@dcompany148
@dcompany148 4 года назад
Abhijeet da's voice is an added advantage for shahrukh chutiya.
@kalidassonawane6818
@kalidassonawane6818 4 года назад
@@dcompany148 matlab tum modibhakt ho 🤣
@deepntom
@deepntom 4 года назад
100% correct
@reshavvo3173
@reshavvo3173 4 года назад
@@dcompany148 king ....of Bollywood 100 percent correct
@dcompany148
@dcompany148 4 года назад
@@reshavvo3173 shahrukh 100% chutiya b hai bhai. Ye b such hai chutiya is king of romance in Bollywood 100% correct
@Tygicupsccseabaiasofficer
@Tygicupsccseabaiasofficer 3 месяца назад
90's most beautiful actress Juhi chawla ❤❤❤❤❤❤
@HabiburRahman-qw6hp
@HabiburRahman-qw6hp 3 года назад
I can't believe my beloved SRK is getting old.. I want him young and joyfull for my lifetime.. Love you SRK
@prabhauniyal1959
@prabhauniyal1959 2 года назад
Habibur Rahman I think u also came at this age since childhood
@burman5017
@burman5017 Год назад
Brother your beloved parent's also getting old to older. Please take care of them.
@mydestination7827
@mydestination7827 3 года назад
SRK at the peak of his career was Invincible! Nobody was even close to him in the late '90s and early 2000s. ❤ with Love from Bangladesh.
@the_epiclore_
@the_epiclore_ 3 года назад
1993-2009 was the SRK era ❤️❤️
@nishchintdesai7991
@nishchintdesai7991 3 года назад
@@the_epiclore_ 1993-till date!
@the_epiclore_
@the_epiclore_ 3 года назад
@@nishchintdesai7991 sorry but I feel 1993-2013 , after that his career started going downhill
@ananyadhaka5048
@ananyadhaka5048 3 года назад
1993-forever
@Greymatter23
@Greymatter23 2 года назад
Srk is the best thing that could happen to this industry..... He is a phenomenon ..which started in the early 90s ..nd will remain till eternity
@riaj5426
@riaj5426 3 года назад
The song is soo romantic. I blush all the time imagining myself with my to be better half. The melody is soo calm, soft and full of love.
@rao433
@rao433 4 года назад
There's somethings magical about Shah-Juhi chemistry. Just out of this world !!
@invista4134
@invista4134 3 года назад
One of the very few songs of Bollywood, that is on my top 5 list. Yes I agree, Shah Rukh and Juhi had an amazing chemistry in this song.
@aryaa_dixit
@aryaa_dixit 2 года назад
The Song is Visually, Lyrically, Musically Perfect. A Classic in its own Right. It's sad that we don't get to see songs like this anymore.
@arungemini2001
@arungemini2001 3 года назад
Ohhh gosh Juhi looks so stunning.. can any of today's actress like Jacquline, Kiara, Disha Patani & others can ever look so graceful.. love this song.. whenever i feel like listening something tranquilizing which can actually transpose to some other world, I listen to this song..
@sameerqureshi988
@sameerqureshi988 3 года назад
Z CA vvmBcbzvbb
@dainabharrat1206
@dainabharrat1206 3 года назад
😇
@heisenberg9584
@heisenberg9584 3 года назад
Isse bhot zyada achhi dikhti hai.kya kuch bhi bolta hai yar
@arpitapanigrahy3551
@arpitapanigrahy3551 3 года назад
@@heisenberg9584 😂😂😂😂 nice joke.
@heisenberg9584
@heisenberg9584 3 года назад
@@arpitapanigrahy3551 there is nothing like joke in this. This is fact
@vinodkumaarr4133
@vinodkumaarr4133 6 лет назад
Whenever Abhijeet has sung for SRK its been pure magic. Just hope they get together again..
@beingsolo80
@beingsolo80 4 года назад
Abhijeet was his lucky charm. SRK went down after breaking that link.
@surajpatel5200
@surajpatel5200 4 года назад
with Abhijeet's reputation in recent years its never going to happen
@vinodiyer2948
@vinodiyer2948 4 года назад
Have not seen a person with so much of head weight....good singer but bad behaviour..... i have seen his concerts & he just doesn't seem to change
@drshaimaaniazy6641
@drshaimaaniazy6641 4 года назад
Sorry the magic come from srk only
@vinodkumaarr4133
@vinodkumaarr4133 4 года назад
Dr shaimaa niazy Don't agree, magic was both ways...
@Shridhar_8080
@Shridhar_8080 5 месяцев назад
This song is really so beautiful, the voices, the sets, the performance and both the actors, juhi and Shahrukh looked perfect together❤❤❤
@sahilmairale8096
@sahilmairale8096 3 года назад
It hurt when I realise SRK is getting older day by day .... but he will always in our hearts forever ❤️❤️😇
@snigdhamohapatra5096
@snigdhamohapatra5096 2 года назад
Are you a big SRK fan?
@snigdhamohapatra5096
@snigdhamohapatra5096 2 года назад
Fan movie of SRK is based on you
@mayurakhibarhoi5429
@mayurakhibarhoi5429 2 года назад
@@snigdhamohapatra5096 🤣
@karishmakumari4458
@karishmakumari4458 2 года назад
Very hurtful🥺
@chanindukavindyaattanayake3774
@chanindukavindyaattanayake3774 2 года назад
Yes.not only srk but im a big fan of old superstars like vyjayanthimala.she was beautiful like a goddess.but now ☹️❤love from 🇱🇰🇮🇳
@nenkhery
@nenkhery 4 года назад
Abhijeet's voice was the most suitable voice for SRK I thought....
@alfarezelfatahillah1043
@alfarezelfatahillah1043 4 года назад
agree. . abhijeet voice also similar enough with shahrukhan real voice in the movie. that's make it so pure
@toniktryadi2683
@toniktryadi2683 4 года назад
Abhijeet memang identik dg SRK. Udit Narayan identik Aamir Khan. Kumar Sanu identik dg Salman
@sirajfriends25
@sirajfriends25 4 года назад
Udit-SRK Abhijeet-SRK Sonu-SRK
@bablubaidya8306
@bablubaidya8306 4 года назад
Yup
@Sr_via1
@Sr_via1 4 года назад
Suitable because of srk
@miszwaheeda
@miszwaheeda 2 года назад
Their chemistry was undeniable! Need them together in a new movie ASAP!! 😍
@JS-yj4cx
@JS-yj4cx Год назад
💯 Agree
@SN-ug4qe
@SN-ug4qe 4 года назад
Why Bollywoodians can't create films like these now? Such a lovely chemistry with decent outfits. Of course the film too Love from Sri Lanka ❤ 2K19 Nov
@Mr.TanvirBengal
@Mr.TanvirBengal 4 года назад
Because Bollywood doesn't like to be Bollywood. Bollywood wants to be Hollywood. Lack of self respect ... Nothing else! I'm a Canadian Bangladeshi.. And undoubtedly a good viewer of Indian films. I still don't get why did they name it "Bollywood"?
@savitanagill
@savitanagill 4 года назад
Hyerrqe to h ya fir bhi nahi hote h ki ring and to hear it from the air in the e mail to you think we can be used for your time hi I am a uui
@savitanagill
@savitanagill 4 года назад
Gdhxhxgx in a y y ie eyryueie email eur j eiei i in regards to hear from you soon and to hear from you soon and will
@PK-rn4lo
@PK-rn4lo 3 года назад
This film had flopped, lol. On a serious note though, today's bollywood is filled with star kids with one particular talent (when they do have one) that is showcased in every of their film and this dumb generation Z swoons all over stupid films.
@novihanindya9948
@novihanindya9948 3 года назад
2021
@rupeshjadhav4713
@rupeshjadhav4713 4 года назад
Give the credit to *JATIN-LALIT* for their amazing music.
@shantii5783
@shantii5783 4 года назад
Absolutely great music director Jatin- lalit
@luzz99
@luzz99 3 года назад
Jdjdjfjgjffjfjdjdf
@rupeshjadhav4713
@rupeshjadhav4713 3 года назад
@@luzz99 😂
@muhammadadnan7771
@muhammadadnan7771 3 года назад
Jatin-lalit 💥💥
@TheMartianMan
@TheMartianMan 3 года назад
Definitely
@astd9729
@astd9729 Месяц назад
What an unforgettable romantic composition by Jatin Lalit ji .Abhijit Da and Alka ji have made the song immortal.
@purnaprakashshrestha4102
@purnaprakashshrestha4102 4 года назад
Shahrukh khan aur juhi chawala dono ki behad khubsoorat love chemistry aur laajawab geet.
@daar483
@daar483 5 лет назад
This type of Dream sequence or imaginative set were created till early 2000's, now no more. I feel sad that majority directors or Film makers of 90's or before have retired or died. Miss the filmmakers like Aziz Mirza , Yash Chopra and many others who gave quantity films to srk
@fahimaahmed3188
@fahimaahmed3188 3 года назад
❤👍
@sandeepshah105
@sandeepshah105 3 года назад
Yash Chopra is not of 2000's.
@geetanjaliramkhelawon6510
@geetanjaliramkhelawon6510 3 года назад
kkklllkkkkll
@geetanjaliramkhelawon6510
@geetanjaliramkhelawon6510 3 года назад
,dd,d,sslslsdksdlsslsls
@swatigautam1916
@swatigautam1916 3 года назад
This totally happen because of technology
@BestGeneralKnowledge
@BestGeneralKnowledge Год назад
I feel so proud and lucky to myself that I was born and raised between 80s and 90s era... golden era of Bollywood music has been ended after 2000 no singer can fill the gap of Kumar Sanu, Udit Narayan, Sonu Nigam, K. J. Yesudas, S. P. Balasubrahmanyam, Hariharan, Abhijeet Bhattacharya, Vinod Rathod, Alka Yagnik, Kavita Krishnamurthy, Anuradha Paudwal, Sukhwinder, K. S. Chithra ,Sadhana Sargam's singing and Lata Mangeshkar.....................💯👍🥰🌹❣
@b.m.k7
@b.m.k7 6 лет назад
SHAHRUKH+ JUHI. AUR KYA. One of my favourite Jodi. 😍😍😍❤❤❤ Evergreen SHAHRUKH ❤❤❤❤❤❤❤❤❤
@yesupillay6777
@yesupillay6777 4 года назад
My favorite Jodi...
@sabihayasmin4081
@sabihayasmin4081 4 года назад
Meri vhi favourite jodi...
@bestsongeversingh9995
@bestsongeversingh9995 4 года назад
Yeahhh that's true this couple looked great in the film Yes Boss also ☺️☺️😎😎😁😁😁
@kaushikdas47
@kaushikdas47 4 года назад
My favorite jodi.
@mansichaudhari58
@mansichaudhari58 4 года назад
Me too
@kumarisamarakoon4417
@kumarisamarakoon4417 4 года назад
Would like to see them together in present cinema...even as elderly characters..such a cute pair❤️
@kimberlychako7269
@kimberlychako7269 Год назад
We haven't seen SRK to be himself in movies in a long long time. That's cs he hasn't worked with Juhi in a while. Bring them back together now!!! no special appearance nonsense just on a full romantic movie
@SarfarajShah
@SarfarajShah 3 года назад
The 90's & early 20's produced some amazing melodies. I can literally play them on my music system & everybody likes it.
@shwetagupta6046
@shwetagupta6046 4 года назад
Srk and juhi has more charming.... Screen couple.... Super talented both.... Kaam se hi Dhikhta hai
@muhammadnayeem3891
@muhammadnayeem3891 2 года назад
Juhi srk nice couple
@muhammadnayeem3891
@muhammadnayeem3891 2 года назад
Ap kaha se hai Shweta g
@souravmitra5191
@souravmitra5191 3 года назад
Every Sunday morning these song played in radio ❤️ we enjoyed a lot ❤️ Memories bring back ❤️
@Anumomo19
@Anumomo19 6 лет назад
I love Juhi Chawla, Kajol, Rani Mukherjee and Aishwarya opposite ShahRukh Khan❤❤❤❤❤❤❤ And Juhi Chawla is something else man she's so beautiful 💖
@pratyushsinha6823
@pratyushsinha6823 4 года назад
I wish and pray... For 2 reunions 1. Shahrukh and Abhijeet 2. Jatin Lalit. (Together again) All four doing a movie together It will be dream come true for me.
@dipzdes2480
@dipzdes2480 4 года назад
agree
@recipesunboxing5563
@recipesunboxing5563 4 года назад
Juhi n Srk bhi
@antaradas1878
@antaradas1878 3 года назад
Same wish...
@AjaySharma-bh4vo
@AjaySharma-bh4vo 3 года назад
ha yr .. Jatin lalit 14 sal se alag h yrr .. ab tk tak to hajaro behtareen gane ban chuke hote
@fluidmechanics8759
@fluidmechanics8759 3 года назад
RD Burman da and Kishore da
@avikgope4156
@avikgope4156 Год назад
Juhi is natural beauty with out any cosmetic surgery.
@kh7688
@kh7688 6 лет назад
Juhi and SRK have great chemistry together. They're both so sweet together.
@feliciafernandes2241
@feliciafernandes2241 7 лет назад
Wow! This song has a dream like quality to it . Just watching the lead pair , makes you want to fall in love all over again! And Juhi looks ethereally beautiful !
@sumitamondal4556
@sumitamondal4556 5 лет назад
Khub valo Gan
@randolfwilliams9577
@randolfwilliams9577 5 лет назад
nice song dear love shahrukh god bless shahrukh 4 ever
@Mujjuiz1
@Mujjuiz1 4 года назад
Wow Felicia,.... Simply adore the usage of the words, very beautifully put!
@mridulak1166
@mridulak1166 3 года назад
Totally agree.
@CW-rx2js
@CW-rx2js 2 года назад
Juhi - so beautiful, graceful and humble!! A true beauty queen :) pageant winners back then were more beautiful and poised!
@saarcful
@saarcful 4 года назад
Wowww, full of goosebumps & tears! It really brought my childhood back, one moment, I went to 1999 and back. It once again blossomed my old memories of teenage!
@fahimaahmed3188
@fahimaahmed3188 3 года назад
❤👍
@pritiag7134
@pritiag7134 Год назад
So true.
@abagthiari9666
@abagthiari9666 3 года назад
SHARUKHS facial/eyes expressions are,.. KILLING😆💘👍JUHI Gorgeous eyes Sweet smile,..👏 Music/lyrics/voice/singing/acting/picturisation,..MEMORABLE😆ROMANTIC👏
@syedawazihaakhter6068
@syedawazihaakhter6068 2 года назад
Credit must go to the singers , actors , composers and every other single person connected to this evergreen song ❤
@nasreenparveen3383
@nasreenparveen3383 2 года назад
T
@AnandiShankar
@AnandiShankar Год назад
Yes I definitely agree with you and also to the whole Orchestra team . They are THE SPINE but Alas! We focus on hero and heroines .😒always.
@thinkshine9522
@thinkshine9522 Год назад
You forgot the legend- the Javed Saahab
@rumani_chakraborty
@rumani_chakraborty 7 лет назад
A song close to my heart since my childhood days..... Still listening to it. Love the chemistry between Shah Rukh Khan and Juhi Chawla.... Great lyrics and heart-touching melody. Songs like this never get old with time... Fresh forever.
@sitifarhanimohdali8046
@sitifarhanimohdali8046 6 лет назад
may I know the lyrics in English? I am from Malaysia and I love this song but have no idea what this song is about...
@arshaanz22
@arshaanz22 6 лет назад
Absolutely true
@vaishalitupkar8955
@vaishalitupkar8955 6 лет назад
Seven heavens song.
@jairamveljibhaipatel5791
@jairamveljibhaipatel5791 6 лет назад
Jairam Patel
@ashishmeshram9883
@ashishmeshram9883 5 лет назад
Taja kab hota hai miss this a song tell me
@sssst6497
@sssst6497 5 лет назад
I have seen many Hindi films. She's truly special. Like today, we need to combine Deepika, Soonam, and Katrina together on one screen to approach her Charisma. Like come on, what she doesn't have in her prime? Her beauty not just beautiful, but gorgeous, so charming and stunning. Her smile with that such intoxicating eyes enough to kill your love, she's sexy too, and don't ask about how great her acting. Such mind-blowingly women. Even Mr. Yash Chopra called her 'The Most Indian Beauty'. She has everything that women dream of. Big Respect!
@mujahidmd1654
@mujahidmd1654 5 лет назад
Bhai itni tarref 😯😯 But jo kuch bi tumne likha wo ek dum sahi. hai. She looks Magical.
@junaidanwar999
@junaidanwar999 5 лет назад
Absolutely true.
@rjnskmr65
@rjnskmr65 4 года назад
Correct bro👍👍
@user-tz5by7ed1h
@user-tz5by7ed1h 4 года назад
Beautiful words really expresses mam juhi beauty
@user-tz5by7ed1h
@user-tz5by7ed1h 4 года назад
💓💓
@sumitakhati8846
@sumitakhati8846 3 года назад
Where is the those goes gone...... Refreshing the mind more and more after listening this song 90s songs are just Wow☺️☺️☺️☺️
@SoumyaGanguly1234
@SoumyaGanguly1234 4 года назад
Juhi madam most beautiful versatile actress..Abhijit mindblowing voice ...
@softskillspathshala5644
@softskillspathshala5644 3 года назад
Beautiful lyrics, silent soothing music, deadly combo SRK Juhi Abhijeet Alka Yagnik....jo ho dil mein kehdo... Aur kya. Refreshing Always 😀😀😀😀
@aesthetic67500
@aesthetic67500 2 года назад
🤗😊😁BACHPAN MEI MUJHE AISA LAGTA THA SRK AUR JUHI HI GAATE HAIN SONGS 😁. BILKUL PERFECT ❤ THIS IS ONE OF THE BEST SONGS and our generation is the last generation jo aaj v sunti hai ye songs🥺❤
@sabrinayasminroshni3248
@sabrinayasminroshni3248 4 года назад
This man lost everything in young age family mom dad his sister got depression then started his career by Seriel Bollywood debut by other rejected movies he never give up life true inspiration shahrukh khan sir😞😭😭😭
@shakilkhan-xc9ub
@shakilkhan-xc9ub 3 года назад
A tribute to Shahrukh Khan
@kanchanchoudhary2836
@kanchanchoudhary2836 3 года назад
Choreography of this song is so beautiful Background,colour combination everything ❤
@subhroneelganguly2580
@subhroneelganguly2580 Год назад
Abhijeet is an example that talent is not enough if you don't keep the attitude right.
@AbidKhan-lr5wb
@AbidKhan-lr5wb Год назад
well said :)
@ovijitbarua5451
@ovijitbarua5451 3 года назад
I still hve hopes to see SRK and Abhijeet would reunite again! Its only SRK who can make this happen.....We miss you the both singing pairs of SRK and Abhijeet....... Plz Sir,Bring Abhijeet back to Ur voice again🙏
@aparajitadas3723
@aparajitadas3723 4 года назад
Shahrukh+ Juhi- "Shahi" jodi of bollywood...😍😘👍
@atieks9676
@atieks9676 3 года назад
Love this couple Juhi Chawla and Shahrukh Khan 💞👍
@jaibheem3267
@jaibheem3267 3 года назад
Kya aawaj hai yaar Ab kyo nhi aate iss tarhe ke singer's yaar 🥰🥰🥰🥰🥰🥰🥰
@ss....7946
@ss....7946 3 года назад
Who listening in october ''2020'' A1🎶
@sandeepparmar7436
@sandeepparmar7436 3 года назад
Me
@arunimalakra1643
@arunimalakra1643 3 года назад
Me
@vishalkalawat2967
@vishalkalawat2967 3 года назад
2050 m bhi yhi song fav hoga mera...ufffff is movie k hr song best h. Meri puri life k liye.....or kyaaaaaa😍😍😍😍😍😍
@kalimsayyad2151
@kalimsayyad2151 3 года назад
Me 😂😎
@nibaditahazarika498
@nibaditahazarika498 3 года назад
Me
@adi-alfalfa
@adi-alfalfa 3 года назад
Unmatchable on-screen pair It just wahoooo...,,👌👌
@theaddictive7655
@theaddictive7655 3 года назад
Ufffff what a great song 🔥🔥 killed it ond juhi crossed all limits of cuteness 😘😘
@amarsaha2005
@amarsaha2005 6 лет назад
I was 19 when I listened to it...After 20 yrs I am listening to it.feeling better.
@user-zc7kp2qd7k
@user-zc7kp2qd7k 5 месяцев назад
Juhi Chawla - most beautiful and talented actress from 90's
@priyapubalan8903
@priyapubalan8903 6 лет назад
december 2017 and still a big fan. no one can beat juhi. she is an amazing star, always have and always will be
@CW-rx2js
@CW-rx2js 2 года назад
Agree!
@ajayblogs1347
@ajayblogs1347 3 года назад
Best romantic Jodi in the Bollywood srk and juhi chawla
@abdullahimohammad9513
@abdullahimohammad9513 2 года назад
The best on screen chemistry is SRK and Juhi.
@tastymusic3176
@tastymusic3176 4 года назад
The real king who was born with crown hidden but was exposed by nature. Finally he proved that he is the king of bollywood.
@azriekamachannel4317
@azriekamachannel4317 4 года назад
2019...i like this song...namaste🇮🇳🙏🏿 from malaysia🇲🇾
@guddangupta5625
@guddangupta5625 3 года назад
Jjgjjg
@kowsar3208
@kowsar3208 3 года назад
I'm 🇧🇩🇧🇩🇧🇩🥰🥰💪😎😎😎😍😍
@Kavita_143
@Kavita_143 3 года назад
Woow Such a beautiful song , I Love ShahRukh ❤💖 aisa lag raha ye song SRK aur Juhi dono ne hi gaaya hai 🤩. I really love this song ,🧡 ShahRukh and Abhijeet Combination is world's best Combo. 🥰Beautiful Song❤💖
@Kavita_143
@Kavita_143 2 года назад
❤❤❤❤ 17th Of July 2022 ❤❤❤❤ And Forever 😘❤🤩😍
@novishartikaompusunggu6908
@novishartikaompusunggu6908 10 месяцев назад
Juhi ❤
@golamsahaniyaz9065
@golamsahaniyaz9065 6 лет назад
Legendary Abhijeet makes the song beautiful. Such a outstanding singer.
@omseif
@omseif 8 лет назад
Juhi is so goregous and she is such a sweet person too ..she & Srk r love!
@kimleendelacruz149
@kimleendelacruz149 7 лет назад
As r5 rt 6g hi
@vaishalitupkar8955
@vaishalitupkar8955 6 лет назад
Nice and molodious.
@jasalbirthshira4900
@jasalbirthshira4900 5 лет назад
What a voice too
@freedbird2145
@freedbird2145 5 лет назад
But juhi got married old man..only for money
@queenofzee
@queenofzee 5 лет назад
@@freedbird2145 SHE DID. MONEY TALKS. CLEARLY SHE IS HAPPY, THAT IS WHAT MADE HER HAPPY. THE OLD GUY IS STILL AROUND AND WILL BE FOR A LONG TIME TO COME :) IF SHE GOT MARRIED THINKING HE WILL BE GONE SOON - DID NOT HAPPEN - YOU LIVE ONCE i SAY - BUT THAT IS WHAT SHE CHOSE.
@avisingh7001
@avisingh7001 3 года назад
Beautiful song. Gave me goosebumps. SRK, Salman, Amir Khan got the best times. Late 90s early 2000s, these were magical times. Songs that made sense, simple and pure acting. Everything was natural. The Indian songs these days are such crap.
@impiyushhh
@impiyushhh 6 лет назад
Srk Sir + Abhijeet Sir = Melodies !!..!!😍😍😘😘!!.!!
@adlinairianahashim7242
@adlinairianahashim7242 5 лет назад
.rwuc a kw aovw howv wba .tw mvs8v wk w vwigwbo .gs ancywivw ca s afbcmvw Fa sts cv nwv ge bscbwb Ca afs ba snvwvtwy vvs wh
@adlinairianahashim7242
@adlinairianahashim7242 4 года назад
.vxnbxbmoo emb dm .oo dnp dbdmboo .nxnbxo xhkool dnd Bdm dmbe m Ndm dboo d.bdb.dm
@maibi2788
@maibi2788 4 года назад
op to Ms Johnson I have a lot of work to so much for dinner tonight if c and I will be in town for a few mins and see how you GG and it was the same as end and the money was taken out for a good times with
@bhumikadudhe8276
@bhumikadudhe8276 4 года назад
When a legend merges with Legend, a super legend is formed. This is the case with SRK and Abhijeetji. Hope to see them together again.
@thekilleradoll3197
@thekilleradoll3197 Год назад
Wonderful .! One is my favourite song.)///
@ravindernathsharma4091
@ravindernathsharma4091 6 лет назад
Wonderful singing by abhijit and alka and wonderful composition. R. N. Sharma patparganj dellhi.
@ifrahmehr6030
@ifrahmehr6030 6 лет назад
Favorite song since childhood.. Such a sweet couple Juhi and Sharukh make💞
@irfankhan-ve3jb
@irfankhan-ve3jb Год назад
Song lines are good but shahrukh acting makes it best.... Evergreen hero... Long live dear❤
@muzammilbehlim4138
@muzammilbehlim4138 5 лет назад
SRK IS Responsible For Thousands n Millions of Teenage Lovers N Boyfriends n Girlfriends In India Bcoz After Seeing His Songs N Onscreen Love Even Most Sincere N Disciplined Boys will Fall in Love Nobody Could Resist N control themself from Liking N Loving Someone . SALUTE TO SUCH A ROMANCE ICON. LOVE U SRK.
@tanialexa10
@tanialexa10 8 лет назад
I looove Abhijeet and Alka, just perfect.
@sufailhamid5625
@sufailhamid5625 8 лет назад
Sasha Talm Hi
@nurseh9758
@nurseh9758 7 лет назад
Sasha Talm
@biplobkhan9533
@biplobkhan9533 6 лет назад
Great song my life
@asifam715
@asifam715 6 лет назад
Hi madem
@Dinesh_Choudhary10
@Dinesh_Choudhary10 5 лет назад
Superb👌👌👌🎤🎤😘
@sheikhjaffar7877
@sheikhjaffar7877 3 года назад
SRK Juhi mam, Abijeet Alka Yagnik, Jatin Lalit .....Aur kya
@Shalinisingh-oj4ip
@Shalinisingh-oj4ip 7 лет назад
Juhi chawla most beautiful woman on this planet n srk juhi made for each other n srk loves her so much in real n y not she is so beautiful so heavenly beautiful. Love u both so much
@annappabe5910
@annappabe5910 5 лет назад
Shalini Singh was planning on it in the
@damayanti4598
@damayanti4598 5 лет назад
Hushjtwhsulsh ÷¢÷`=Π`√°Π°°¢Π
@rifky7796
@rifky7796 3 года назад
You're right
@Emily-ez2pt
@Emily-ez2pt 4 года назад
One of the best song of srk... Looking so sweet srk
@RohitKumar-pu2pb
@RohitKumar-pu2pb Год назад
Yeh gana solid no people empty Alley's streeets
@infinitynetwork5605
@infinitynetwork5605 3 года назад
This movie and it's songs were way ahead of its time
@krishnasingh3424
@krishnasingh3424 7 лет назад
It's Top songs of ...90 SRK With Juchi..☺☺☺☺
@rajmun3113
@rajmun3113 6 лет назад
Raju
@rajmun3113
@rajmun3113 6 лет назад
Nic song
@Dee-kk8pe
@Dee-kk8pe 3 года назад
This videography , the best ever I've ever felt 💥🙏🙏🙏
@RiteshBhanushali
@RiteshBhanushali 8 лет назад
most romantic song of srk !
@rohanihashim9794
@rohanihashim9794 6 лет назад
I love shk .
@kumariching4699
@kumariching4699 4 года назад
loveyou🎊🎊🎊🎊🎊🎊🎊
@pawanvishkarma3535
@pawanvishkarma3535 4 года назад
I listened this song when I entered my first day of school in the year 2004.I was in school van and driver was listening this song .What a golden days they were 2000-2009 year.
@fahimaahmed3188
@fahimaahmed3188 3 года назад
👍
@starthawani3456
@starthawani3456 2 года назад
❤️
@khatarahemerapet
@khatarahemerapet 3 года назад
This is goddamn beautiful. Still makes me feel so pumped ❤️
@behts6488
@behts6488 8 лет назад
omg i looooove this song, its so dreamy and just beautiful
Далее
Aik Din Aap Yoon Ham Ko Mil Jain Gay
4:20
Просмотров 1,1 млн
ДОКАЗАЛ ЧТО НЕ КАБЛУК #shorts
00:30
Просмотров 906 тыс.
POV: Your kids ask to play the claw machine
00:20
Просмотров 9 млн
Men Vs Women Survive The Wilderness For $500,000
31:48
гендер пати🩷🩵
00:21
Просмотров 58 тыс.
ДОКАЗАЛ ЧТО НЕ КАБЛУК #shorts
00:30
Просмотров 906 тыс.