Тёмный

The Ghost Rider’s First Ride | Ghost Rider (2007) 

NOW PLAYING
Подписаться 1,4 млн
Просмотров 16 млн
50% 1

GHOST RIDER (2007) is NOW PLAYING and can be found to Rent or Buy here: DP.SonyPictures.com/GhostRider
Find the sequel here: DP.SonyPictures.com/GhostRider...
When motorcycle rider Johnny Blaze sells his soul to the Devil to save his father's life, he is transformed into the Ghost Rider, the Devil's own bounty hunter, and is sent to hunt down sinners.
Watch More:
► Need a Smile? Subscribe to Now Laughing: bit.ly/39UENSw
► Need a Fright? Subscribe to Now Scaring: bit.ly/39UENSw
► Have less time? Subscribe to Shorts: bit.ly/39UENSw
NOW SCARING is a channel made for movie fans, by movie fans. Here you will find all of the most memorable moments, scenes, trailers, and more from all of your favorite horror films.

Кино

Опубликовано:

 

15 авг 2022

Поделиться:

Ссылка:

Скачать:

Готовим ссылку...

Добавить в:

Мой плейлист
Посмотреть позже
Комментарии : 3,3 тыс.   
@iamajay3333
@iamajay3333 Год назад
No CGI just real life scenes captured by cameras. Nicolas cage is a legend
@jeremygray462
@jeremygray462 Год назад
always
@jasonabraham6061
@jasonabraham6061 Год назад
He really is every movie especially those thrillers are so good
@cre7701
@cre7701 Год назад
@@kronos4669 tu chu h ..sarcasm tha uska comment
@blarginsnitchal
@blarginsnitchal Год назад
@@epicawesome5464 More!!
@TheBlueShark
@TheBlueShark Год назад
Can't believe Nicholas Cage actually had to burn all his skin and organs off just for this role
@yommish
@yommish Год назад
“You’re going down” “Sorry, all outta mercy” Brilliant writing
@allighast9714
@allighast9714 Год назад
It's like they wrote both lines expecting them to choose one for the final draft and then they just gave it to the other car instead
@Dennis_Reynolds
@Dennis_Reynolds Год назад
Shakespearean levels of writing.
@graememontrose1741
@graememontrose1741 Год назад
Yeah, for the latter i woulda gone with "I am the Spirit of Vengeance...don't ask me for mercy."
@LegacyKnight-zm6vz
@LegacyKnight-zm6vz Год назад
Gressil: Have mercy Ghost Rider: Didn’t say “please”. Maybe not the best, but better IMO lol
@BigBoss-dt4jv
@BigBoss-dt4jv Год назад
Didn"t knew the Rider should be so eloquent...
@jaseem4356
@jaseem4356 19 дней назад
Anyone watching in 2024?
@jesuranjesu3708
@jesuranjesu3708 14 дней назад
Yes sit🥷
@KaranKumar-wm1il
@KaranKumar-wm1il 12 дней назад
Yes lot of people are watching this video in 2024
@MusicOfficial-pg3lw
@MusicOfficial-pg3lw 12 дней назад
Ayooo
@inc7892
@inc7892 12 дней назад
Hell 🥵🥵Yeah
@HarisKhan-nw7hl
@HarisKhan-nw7hl 12 дней назад
No im from 1673
@Illuminatty1
@Illuminatty1 4 месяца назад
"He ain't so tough" gets hit with one punch n says have mercy 😂😂💀
@thanhaislam1810
@thanhaislam1810 2 месяца назад
😡😡
@AMETHYST21897
@AMETHYST21897 2 месяца назад
“Sorry. All out of mercy.”
@dude-jk2hn
@dude-jk2hn 2 месяца назад
But how did GR survive that truck?
@AMETHYST21897
@AMETHYST21897 Месяц назад
@@dude-jk2hn when you think real hard about it the Ghost Rider is actually a spirit. Perhaps its hellish powers allowed it (and by extension, Johnny Blaze) to survive the truck crash unharmed ?
@mirandaalifkarim3420
@mirandaalifkarim3420 Месяц назад
Ghost Riders can t be k illed by anything exc ept holy weapons
@Christoph1712
@Christoph1712 Год назад
3:39 As a Biker I can confirm that this is what it feels like to go for the first ride after winter break :D
@gumballer133
@gumballer133 Год назад
That's how I feel every year when I get on my Turbo 2 stroke snowmobile again. Haha.
@amitthapliyal9787
@amitthapliyal9787 Год назад
U really had winter break...its just oosome feeling riding in winter in hills with sunshine...
@trevorsawyer2272
@trevorsawyer2272 Год назад
It does it so does
@aamirhoda7363
@aamirhoda7363 Год назад
Damn yeahhh 🔥🔥🔥🔥
@COMEDIC_EDDIE
@COMEDIC_EDDIE Год назад
Hahaha...every day after work
@dolphinsfan3245
@dolphinsfan3245 Год назад
Say what you want about this movie, but Nic cage killed it in this role. Especially this first transformation scene. Epic !
@BonifaceJoseph
@BonifaceJoseph Год назад
LMAO, No.....its a shit movie
@Philip_023
@Philip_023 Год назад
Yeah... One of the best adaptations from Marvel
@jeremygray462
@jeremygray462 Год назад
@@BonifaceJoseph what r u for real
@greatninja2590
@greatninja2590 Год назад
@Most Heinous Gamer ! nah it is a bad film acting was okay would have benefit with competent writer though.
@neardarkroad1347
@neardarkroad1347 Год назад
@@greatninja2590 it is no masterpiece, that is for sure...but it is still a fun movie to watch
@user-qc1ub7mb2z
@user-qc1ub7mb2z 6 месяцев назад
In 5:54 to 6:19 , It was still Johnny, screaming in pain. But in 6:20, it was already the Rider being glad and happy to be freed again in a new vessel.
@brennanhunt2722
@brennanhunt2722 21 день назад
I wouldn't say he was in a "new vessel"; I'd just say the Spirit of Vengeance is back on earth. Anyone could become the Ghost Rider, it just depends on what possesses you!
@akiharashuguro2141
@akiharashuguro2141 День назад
​@@brennanhunt2722 i still don't get it
@Raigoth
@Raigoth 9 месяцев назад
The transformation scene is so accurate as to what might happen to someone in that amount of pain. While not as bad as it is to burn like he did from the inside out, I once experienced the same type of thing happen. I dislocated my left knee and instantly was on the ground. Pain was so bad that all I could do was laugh. Thought I was going crazy.
@livinglegend9709
@livinglegend9709 Месяц назад
Well one coukd say that zatharos( the angle of vengeance inside cage) is coming out. Since zatharos is pretty much insane, those laughs could be him being happy hes finally been released
@alexcorrales7322
@alexcorrales7322 Месяц назад
Calm down edgelord
@Raigoth
@Raigoth Месяц назад
@alexcorrales7322 I'm perfectly calm. Not sure how describing my own pain as well as giving an opinion on a movie makes me an "edgelord" wanna elaborate or are you just here to try and be a troll of some sort?
@caramellpanda
@caramellpanda Год назад
This movie was pretty raw for a 2000s movie, it still holds up pretty well and Peter Fonda did an incredible job as Mephistopheles.
@torquetheprisoner
@torquetheprisoner Год назад
he was in easy rider
@jamessantiago2682
@jamessantiago2682 Год назад
More like Mephistopheles did an incredible job as Peter Fonda
@ashirvadin
@ashirvadin Год назад
As did Ghost Rider as legendary Nicolas Cage.
@vladimirmarianoreis8353
@vladimirmarianoreis8353 Год назад
aLp
@chairthing
@chairthing Год назад
Acting opposite a Coppola, you need to go all in
@mjkhan9664
@mjkhan9664 Год назад
15 years later and this is still one of the coolest moments in marvel films. Just imagine this version of Ghost Rider in the MCU. Also Nicolas Cage always did have a way to just slay the crazy moments and that transformation really did show his abilities quite well
@Deinobi
@Deinobi Год назад
let's be honest here, whatever Disney can cook up right now could never be as cool as this
@Yodoggy9
@Yodoggy9 Год назад
@@Deinobi I disagree; if Disney could work Cage into being an older Ghost Rider, like the cowboy one we get in this movie, it could easily surpass the cool factor! They’ve got the money for it, too!
@darkvoid3182
@darkvoid3182 Год назад
@@Yodoggy9 disney only cares about money not the community
@dasunwilson8610
@dasunwilson8610 Год назад
ru-vid.com/video/%D0%B2%D0%B8%D0%B4%D0%B5%D0%BE-7IvEhLNC4NU.html🥰
@Papa_Straight
@Papa_Straight Год назад
@@Yodoggy9 yeah they would cast a female ghost rider and make all the males look bad
@oddfreaks6452
@oddfreaks6452 Год назад
Man I love how they didn’t use CGI for the transformation and instead just let Nicholas Cage use his own innate talent.
@drzen7703
@drzen7703 9 месяцев назад
Cage's performance is so perfect, so sad it didn't hit. wish to see more cage play as role of superhero. he deserve more.
@beukenphom3680
@beukenphom3680 Год назад
That laugh from Johnny is just amazing ...it's not him but the Rider inside him waiting to come out after a long time that's what makes him to laugh !!!!
@reixie
@reixie Год назад
u mean vengeance?
@superyoshiemonster3008
@superyoshiemonster3008 Год назад
Like johnny himself is screaming in mortifying pain while the rider is laughing, finally being out again after years of being hidden, it makes sense because at first Johnny is screaming in pain and doesnt know what's going on but when his skull is exposed and in flames he turns to sudden laughter, amazing writing and acting, amazing
@ryanroubert2483
@ryanroubert2483 Год назад
Not a rider inside Johnny. He was possessed by Nicholas Cage
@potatoechip2757
@potatoechip2757 Год назад
Ahaha😂
@Mash3OH3
@Mash3OH3 Год назад
It’s laughing at Johnnys futile attempt at trying to resist it lol
@Simmychann
@Simmychann Год назад
Damn I remember watching this movie everyday after elementary school now I’m 21 and this shit still go hard
@chasethemoney6129
@chasethemoney6129 Год назад
Facts makes me wanna ride
@Simmychann
@Simmychann Год назад
@@chasethemoney6129 fr fr
@jackthecommenter2768
@jackthecommenter2768 Год назад
@@Simmychann fr fr fr
@KhaledMohamed-is5pl
@KhaledMohamed-is5pl Год назад
Yea I am 28
@AdrienRBLX
@AdrienRBLX Год назад
Same bro btw I'm 18 now
@bradycampbell5321
@bradycampbell5321 10 месяцев назад
16 years later, and this is STILL one of the most well put together sequences in any marvel movie
@davideromano627
@davideromano627 7 месяцев назад
The ghost rider's trasformation was like something beyond hell
@abdizur8765
@abdizur8765 Год назад
I really hope Nick's version of Ghost Rider exists somewhere out in the Multiverse for the MCU.
@Jmzhockey92
@Jmzhockey92 Год назад
no doubt
@Cerdo_asqueroso
@Cerdo_asqueroso Год назад
Nicholas Cage should never ever be ghost rider. The only reason why he was in this role was because he annoyed the director day and night to get the role, but that role was supposed to be for Jhonny Depp.
@Antwannnn
@Antwannnn Год назад
He does. Everything goes. Even you 😉
@Luka2000_
@Luka2000_ Год назад
@@Cerdo_asqueroso no need to spam the comments
@iceberg6140
@iceberg6140 Год назад
@@Cerdo_asqueroso in all honesty I don’t think Johnny Depp would have suited the role of this character, nic performed perfectly he’s got that badass look to him and I think he pulled it off being the ghost rider I don’t think I can see Johnny being that sort of badass type. You have to admit we can’t unsee Nicolas as not being ghost rider. Despite how he got the role I 100% agree he nailed it for sure. Good on him👍🏻
@OfentseMwaseFilms
@OfentseMwaseFilms Год назад
Why did this movie receive so much hate? It looks Great
@Jairah0613
@Jairah0613 Год назад
Don't care about the haters care about the lovers
@user-vr8fs8gg6h
@user-vr8fs8gg6h Год назад
It looks awfull dont lie
@ameybirulkar7503
@ameybirulkar7503 Год назад
@@user-vr8fs8gg6h still much better than fat Thor and professor hulk
@user-vr8fs8gg6h
@user-vr8fs8gg6h Год назад
@@ameybirulkar7503 that sucks aswell but so does this
@ameybirulkar7503
@ameybirulkar7503 Год назад
@@user-vr8fs8gg6h no
@kevinlockhart2000
@kevinlockhart2000 7 месяцев назад
6:43 I can only hear "spongebob is faithful" and I might never be able to unhear that.
@lonelyboyandhistelephone5697
@lonelyboyandhistelephone5697 Месяц назад
Damn you Now I can't unhear it
@randompat5772
@randompat5772 Год назад
Anyone else love the soundtrack in this film? Especially those dark guitar riffs like at 1:28. Christopher Young doesn't get enough credit for his work. He also did the music for Spider-Man 3 btw.
@xManAvenger
@xManAvenger Год назад
His transformation scene still gives me goosebumps, the cgi still holds up!!
@deadpool3466
@deadpool3466 Год назад
for now...
@endeliggnist5066
@endeliggnist5066 Год назад
You're kidding, right?
@xManAvenger
@xManAvenger Год назад
@@endeliggnist5066 I mean the transformation, like with his skin melting… not the ghost rider cgi.
@mamigyllenhaal2726
@mamigyllenhaal2726 Год назад
​@@xManAvengerdon't you know? That particular scene was completely improvised by Nic Cage, no CGI or whatever, the man simply unleashed his inner Cage, seeing this, the director just kept on filming, and his decision clearly paid off.
@truongduynguyen3365
@truongduynguyen3365 Год назад
​@@mamigyllenhaal2726 jqvfkdkkdkflfmkckfkfkfkkkkfkdikriirifirfkfxjjdjdjxjdkdkkddkkfrkfifkeiirfiieeiieifeifidiriddjrjkfrjfkrifkrifiririirjrirriirrjritkrkrrifkfjfiififijrrjrirfiriirririirifrjrirfirifirririirfirigirriitk😢❤😢😢😅😅😅😅😅😅😅😢😢😢😢😢😢😢😢😢😢😢😢😢🎉🎉🎉🎉😢😢😢😢😢😢😢😢😢kkdkfkrkiekdjdjdjiiddiififififjfifirfiririir😂y😢😮😮😮😮😮😮😢😮😮😢😢😢diiiidifiidififiifodorororroifjfrdidrjrifidifiifififdideirirrieisksiiswieieeieiddieiisieiieeeieieidieeeiieidieeiiieieieieeiiieeieeeieddieiririeieieieiieifoerere😂😂😊😅😊😊😊😊😊😊😊😊😊😊😊😊😊kdeiiddriridiriirrrrririrriirioroeoroerriiorrirrirririririeiirriirimhullggvkklfdjjkjjhhigdfgvjugzvcffffffbhggggffvgfgbgggnbhhjjhhhhhjjhhffgnkyhkjrdjyrfhhhgjjhhbggngfbhjnnjhtrnjhhhgbvvggjjgfffcdffffjifddhjjjddfmkm GvcdsssaZ😙😆😅🤣😀😍😭😁😅😆😅🥰🤩😊😍🥰😀😃😃😭😀🥰🥰😍🤩🤩😭🤣😆😘😂😊😅😘😆😁😁😀rhhhjbghnrbhnhghjhhhhhlheenhggffffgjyhrbregedhegretheefgerherbrgbrrtgggggffmmgdwqqwhkujjkkiookiiioigreseesghjjjjhfewqqjukjjjjyjjjtewqaaskouteyfhjiurrsdfhjiyyuffrrfjgyhggyygggttthrgbrgrghgrrrgfrrrrrrrffffffttrrreruiueueeueueeudeudeucrsnidjejjenjcejxjdjxeifrkicekidejiwiiedjsidjexidieijdcjdjejxjdsjxieidsidjjjjuwiejiedididiwiieiwidieisiudjdudidieisisidideiwixiweisieieoediidieekedkdkdoidididdiddjdjdi
@SlapperTV
@SlapperTV Год назад
Great movie, just one thing annoying is that it doesn’t show the true power of the Ghost Rider. Literally one of the few Marvel characters to take out Thanos but for a 2000s movie this movie was great!
@ludvighstrup4266
@ludvighstrup4266 Год назад
This is not great movie not 2000 movie is 2007 movie
@Dante-tb7gc
@Dante-tb7gc Год назад
Lmao it’s necessary to nerf OP characters buddy. Imagine if Lucifer(Netflix) was in accordance with his true powers per comics. There’d be no drama, no plot.
@SlapperTV
@SlapperTV Год назад
@@ludvighstrup4266 I meant as in a 2000s movie
@SlapperTV
@SlapperTV Год назад
@@Dante-tb7gc Why do they need to nerf him? If they brought the Ghost Rider back to the current MCU there’s quite a few opponents they can have challenge him and still have a great plot… Even tho Mephisto and his son were the main enemies in the comics and in these movies there are other powerful rivals of the Ghost Rider that they can make bad ass with the Cinematic Universe version 🤷‍♂️
@brucesbanner5057
@brucesbanner5057 Год назад
Good for a 2000 movie lol. Bruh this is 2007. you do know movies like Lord of the Rings and The Matrix were already out by now. This movie is garbage and looks like a group of kids made it for highschool drama class. The story, the cgi, the acting. All terrible.
@Artisan1979
@Artisan1979 7 месяцев назад
9:42 changing the sound of the engine to something demonic works perfectly
@alcoholically4280
@alcoholically4280 6 месяцев назад
You can tell that transformation was PAINFUL asf. From the first *GAHH* like he was literally getting burned away from the inside. They/Nick Cage did a great job at showing the pain Johnny was experiencing. Ik that had to have been literal torture especially with Zarathos taking over
@DrJekyll38
@DrJekyll38 Год назад
This was by far the most malevolent character Peter Fonda ever played, but he pulled it off like no one else could. May an amazingly good actor rest in peace.
@richie9308
@richie9308 Год назад
He really carried the film I thought.
@debojitdowarah
@debojitdowarah 8 месяцев назад
জন দদভথলযতথযমতথথণচ
@ohdannyboy9675
@ohdannyboy9675 Год назад
That motorcycle transformation at 9:15 is way more wicked than I remember Ghost Rider rocks!
@evolve_exo2133
@evolve_exo2133 9 дней назад
I remember my dad showing me this movie in 2003 still a ghost rider fan today
@soulfulfool
@soulfulfool Год назад
that bike transformation never gets old
@amogh_theone
@amogh_theone 6 месяцев назад
This movie was gorgeous, I still came back to watch this scene over and over. It bring certain level of satisfaction inside of me that I can't articulate in human sense.
@AlanKaroff
@AlanKaroff Год назад
Nicolas Cage perfectly portrayed the burning alive from the inside. No one, I repeat - NO ONE could do that.
@Json13th
@Json13th Год назад
I can
@shadowfor1995
@shadowfor1995 Год назад
I did it yesterday lol big deal
@thanqualthehighseer
@thanqualthehighseer Год назад
Have you never had a extra spicey Taco meal?
@ooofsized2036
@ooofsized2036 Год назад
most people can lol
@FireTotodile
@FireTotodile Год назад
diarrhea
@manugulati1105
@manugulati1105 Год назад
One of the greatest acting performances I’ve ever witnessed. Thank you Nic Cage!
@Cerdo_asqueroso
@Cerdo_asqueroso Год назад
Nicholas Cage should never ever be ghost rider. The only reason why he was in this role was because he annoyed the director day and night to get the role, but that role was supposed to be for Jhonny Depp.
@aBhi-oz4hu
@aBhi-oz4hu Год назад
@@Cerdo_asqueroso I like Johny but i don't think he will fit for this role. Nic did a great job
@personalclasslog6972
@personalclasslog6972 Год назад
@@Cerdo_asqueroso copy pasting the same shit in every thread?
@Cerdo_asqueroso
@Cerdo_asqueroso Год назад
@@personalclasslog6972 Oh I dont know what you are talking about. Maybe you are crazy, or maybe you saw a bot.
@randomfatman339
@randomfatman339 Год назад
@@Cerdo_asqueroso nah you said the exact same thing under a different comment
@markhernandez6734
@markhernandez6734 8 месяцев назад
Still the best transformation ever in a movie
@leeroy5665
@leeroy5665 8 месяцев назад
Most believable live action transformation ive ever seen. The water starts to first burn away from his eyes since they have the most exposed mositure. The pain from his body completely burning away, then the euphoria of knowing secrets of the universe while also holding massive anounts of power realizing you now feel the best youve ever felt, all while experiencing the most intense pain you have ever felt, realizing its almost over and going absolutly fucking BALLS TO THE WALL PSYCHO haha.
@kobi005
@kobi005 Год назад
I love this scene, I especially love how he transforms the bike and starts riding it by saying "It's Ghosting Time!"
@Rodney_G2A
@Rodney_G2A Год назад
Its Rider time
@tommyvercetti1111
@tommyvercetti1111 Год назад
Ghost rider ghosted me 😤
@Aaleg
@Aaleg Год назад
It’s ridin’ time
@mr.knight8039
@mr.knight8039 Год назад
Truly one of the scenes ever
@kevinduliesco5468
@kevinduliesco5468 Год назад
My crush ghosted me
@abhijitdas2987
@abhijitdas2987 Год назад
I don't care how bad or good this movie was. All i want is another Ghost Rider movie in MCU but powerful as he is in comics.
@deadinside7002
@deadinside7002 Год назад
@@SmartIndian_7337 is it good?
@ididntmeantoshootthatvietn5012
​@@deadinside7002 lol when overproud indian people want you to watch that, of course its not good
@princemonzzzi2174
@princemonzzzi2174 Год назад
@@deadinside7002 nope
@Tenchi707
@Tenchi707 Год назад
@@ididntmeantoshootthatvietn5012 😂
@unexplainedaf7469
@unexplainedaf7469 Год назад
@@ididntmeantoshootthatvietn5012 What they say to every Indian man who becomes an actor: Welcome to Bollywood - would like a mustache or a beard?
@BateMasterJeff9887
@BateMasterJeff9887 3 месяца назад
This movie is so underrated. I love it!!!
@akashsunshine7133
@akashsunshine7133 3 месяца назад
No 1can beat this movie in theaters.. 💞🔥turbo
@shoulderguy6397
@shoulderguy6397 Год назад
Johnny: I'm not doing it Devil: you don't have any choice. So badass
@driftersforge4962
@driftersforge4962 Год назад
I like this version better than the second one. Mainly because the way his skin wad burning of seems like it would translate somewhat well into actual reality.
@furionmax7824
@furionmax7824 Год назад
But the second is honestly good bc the fire is more realistic looking with the smoke coming off. And the fact that the bike, chain, and his clothes are bubbling like hot tar and charcoal black from the fire instead of this heavy metal looking skull look. It shows how the hellfire coming from Blaze is corrupting everything he's holding instead of just giving it a cool redesign. Zarathos was a corrupted angel of justice. Therefore his fire corrupts anything it touches.
@guyfawkesii7532
@guyfawkesii7532 Год назад
I agree, but I wish they would have kept his Penance Stare the same as the first movie too, unless they did that to show he's an unstable Ghost rider lol
@Caliif
@Caliif Год назад
@@furionmax7824 my biggest problem was that they didn't keep it consistent, I like the way he is portrayed in 2 but it's to big of a change looking at the first movie.
@furionmax7824
@furionmax7824 Год назад
@@Caliif well in the beginning it's implied he's been the rider for a while. He fled to a whole other continent bc he couldn't control zarathos anymore. But the change could've been done better. Like in the first one where his skin burns off. In this one it kind of just transitions I guess.
@Caliif
@Caliif Год назад
@@furionmax7824 they should have shown how he loses control in a flash back or in the first movie, because here he can control it he just isn't used to it and in the second it's instantly "it's to dangerous, I can't let him out"
@hishamramzan5310
@hishamramzan5310 Месяц назад
This movie is what made Ghost Rider my #1 favorite Marvel hero
@kushunadkat9087
@kushunadkat9087 9 месяцев назад
Nic Cage was so perfect for this! We need him again.
@stepanserdyuk4589
@stepanserdyuk4589 Год назад
It's interesting how both movies have their own ups and downs. If only we could get the third one that would combine the best of two worlds.
@kunalapte5816
@kunalapte5816 Год назад
Could u elaborate on what things did both movies do best in their own way ? Edit: I'm not mocking tho, just genuinely asking for ur opinion.
@tc-channelhobby4051
@tc-channelhobby4051 Год назад
Two was shit to be honest, remake the second to fit the first narrative like the game did.
@xtrydelta7596
@xtrydelta7596 Год назад
needs more metal music
@juju_mitch
@juju_mitch Год назад
The second one was God awful.
@dasunwilson8610
@dasunwilson8610 Год назад
ru-vid.com/video/%D0%B2%D0%B8%D0%B4%D0%B5%D0%BE-7IvEhLNC4NU.html
@kahoo.manawanui
@kahoo.manawanui Год назад
I was 17 when I first watched this movie. The bike transformation scene was always badass to me.
@deadpool3466
@deadpool3466 Год назад
heh
@christianwilliam3687
@christianwilliam3687 Год назад
Hello 🤗
@jakobhardy1734
@jakobhardy1734 Год назад
@@deadpool3466don't you remember the time he penance stared you?
@deadpool3466
@deadpool3466 Год назад
@@jakobhardy1734 No. I could not see anything cuz my super suit was on me backwards on accident.
@deadpool3466
@deadpool3466 Год назад
@@jakobhardy1734 what does penance mean? it sounds dangerously close to sounding like penis. Im worried.
@azmathahmed2476
@azmathahmed2476 23 дня назад
Greatest scene ever in movies without doubt
@godzilla0974
@godzilla0974 5 месяцев назад
That’s one hell of an entrance.
@yashwerewolf8825
@yashwerewolf8825 Год назад
Ghost rider is one of the best and most underrated comic book character ever... Nic Cage was dope .. I've seen this movie in theatre and it's nuts..🔥
@anuvindm2092
@anuvindm2092 Год назад
7:50 Now That's what we call a brilliance
@lafecide9480
@lafecide9480 7 месяцев назад
nostalgic. a great movie for it's time .
@sanskarsharma1138
@sanskarsharma1138 8 месяцев назад
From childhood always my fav movie but those dialogues i undrstood now , its really humourous 😂 like hows my driving written on truck after hitting GR 😂 and many instances i still laugh like hell 🤣🤣🤣 he was the deadpool of that time i must say most badass 😂
@soupsock9743
@soupsock9743 Год назад
"You're going down!" "I don't think so" 10/10 performance right there
@deadpool3466
@deadpool3466 Год назад
🥫🥫
@leakedclipsdaily
@leakedclipsdaily Год назад
This guy has all this power but can't do it himself? Johnny has a point.
@ashirvadin
@ashirvadin Год назад
That's because it's not Mephistopheles's power. The Ghost Rider is Zarathos who is just under the control of Mephistopheles almost like a pet predator.
@tormentor2285
@tormentor2285 Год назад
mephistopheles was always quite limited almost everywhere, he follows strictly his code, and it works
@Klimbo93
@Klimbo93 Год назад
Say again, USA vs Russian every conflict last century?
@jeepamir508
@jeepamir508 Год назад
The thing is Mephistopheles limited on Earth with his powers. That's why he needs Rider
@Mash3OH3
@Mash3OH3 Год назад
The Ghost rider is pretty much what the Silver Surfer is to Galaxtos A supernatural herald lol
@kyrusbrightfuljr.2830
@kyrusbrightfuljr.2830 2 месяца назад
I loved this movie. Way better then part 2. This was a classic, just like fantastic 4.
@Artvy1
@Artvy1 8 месяцев назад
And Peter Fonda is marvelous in his acting as Mephistopheles!
@RAY.POLARIS
@RAY.POLARIS Год назад
4:30 the cops was like" Okay I got it I won't be trying to catch him otherwise I'll make a fool out of myself"!😂
@Darthrevanthedarklord
@Darthrevanthedarklord Год назад
@@synophobia876 Tengen?
@louisrobitaille5810
@louisrobitaille5810 Год назад
My favorite part of the whole movie is definitely this scene at 6:55. Wes Bentley's expressions are perfect with the Ghost Rider's punch lines :D
@harryguidotti3815
@harryguidotti3815 Месяц назад
This is definitely up there on my list of favorite transformations.
@DBfan106
@DBfan106 Год назад
Even after all these years, this movie is still just SO FREAKING COOL! Don't care how old I get Ghost rider will always make me smile!
@JarvisBaileyVA
@JarvisBaileyVA Год назад
A lot of people with myself included give Nic Cage credit for this scene and rightfully so. He's not so up his own ass that he's above going over the top and goofy for a transformation into an insane flaming demon.
@welovephilippineswithmylov5419
😱
@sweetpsycho2022
@sweetpsycho2022 Год назад
😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱
@lukahmad5683
@lukahmad5683 Год назад
That CG was great knowing that they did this in 2007, I love this movie. Hope they have variant of Cage's Johnny Blaze in MCU.
@momotow8286
@momotow8286 9 месяцев назад
i was blown away 10 years ago, and I am blown away now....
@The97Moose
@The97Moose 7 месяцев назад
Couldn't put my finger on it, but I love how Mephisto, Blackheart, and The Hidden (Abigor, Gressil, and Wallow) talk in their normal voices, but you can hear the demonic background speech under their breath.
@fin9365
@fin9365 Год назад
7:02 me confronting my cat on the counter at 3 AM eating the bread bag
@edd4816
@edd4816 Год назад
Your cat: "We're not going to have a meaningful conversation now are we?"
@darrenwallis7630
@darrenwallis7630 Год назад
4:26 i feel they missed a trick the speed gun should’ve recorded 666
@brianmason8400
@brianmason8400 Год назад
Hahahaha... nice one !
@Luis-tz8kt
@Luis-tz8kt Год назад
speed gun can’t track anything above 300 range
@darrenwallis7630
@darrenwallis7630 Год назад
@@Luis-tz8kt like this movie follows any like of logic or realism?
@cold_tn4890
@cold_tn4890 10 месяцев назад
Finally I funny RU-vidr that goes straight into the clip thank you this is my favorite movie
@Tenshi-Quinn
@Tenshi-Quinn 8 месяцев назад
If you watch the whole sequence of him doing a 'pop-o-wheelie' @3:54 and watch it at 0.25x speed - you will see it was Tom Cruise who did the bike stunt for Nick Cage.
@MeesumAliAbbasi
@MeesumAliAbbasi Год назад
Ghost Rider & Nicholas Cage was perfect combination....no one can execute this role except Cage.
@1motorcitychop
@1motorcitychop 9 месяцев назад
Keanu Reeves says hold my 🍺 😂😂😂 🍺
@VERGILGASM
@VERGILGASM 7 месяцев назад
​@@1motorcitychopI don't think he'd accept
@jigzyonline
@jigzyonline Месяц назад
​@@1motorcitychopyes with his monotone ass voice. He couldn't do this.
@och1443
@och1443 Год назад
6:23 normal tuesday for nicolas cage
@Luqmanabdullahsani299
@Luqmanabdullahsani299 Год назад
6:33 that evil laugh while trasnforming is iconic
@Xientiqq_Society
@Xientiqq_Society 5 месяцев назад
Aside from pirates of the Caribbean series this is my best movie as a kid and even now. I just love all of it I can’t even cap
@Dele-Deli
@Dele-Deli Год назад
6:42 i like when he puting his head up while the music plays
@rotoz4life664
@rotoz4life664 Год назад
6:33 is me when i finally get the last kill on fortnite😂😂
@alcoholically4280
@alcoholically4280 Год назад
This movie and their *ODD* finger pointing thing is hilarious. Still love this movie foreverrrr
@jodyreeder4820
@jodyreeder4820 3 месяца назад
Still love this
@jhay3966
@jhay3966 Год назад
7:16 ahhh yes. . . Air, Water, and truck driver
@krkMuse
@krkMuse Год назад
Nick may be the greatest actor alive today. From performance to keeping his life in check and keep his private life private, a true gift for mankind.
@bananatiergod
@bananatiergod Год назад
Dude spends thousands of dollars on the craziest shit left and right and ends up with insane debts he has to pay with his movies. Can't call that 'keeping his life in check' LMAO He is a pretty chill dude tho, and I love his mindset on acting. Definitely an interesting guy.
@j.calvert3361
@j.calvert3361 Год назад
He did quite a lot of lame movies and some outright trash ....
@sarcasticguy4311
@sarcasticguy4311 Год назад
Said nobody ever.
@zulkamal9191
@zulkamal9191 7 месяцев назад
The bike transformation is the best..very nice Cgi..
@secretgarden3555
@secretgarden3555 3 месяца назад
Nicolas Cage at his best.❤‍🔥
@NateDogg8866
@NateDogg8866 Год назад
“Please, have mercy” Bro you just hit me with a semi
@commanderrockwell
@commanderrockwell 7 месяцев назад
This movie is so freaking awesome. GREAT ACTORE JUST ABSOLUTELY AMAZING
@all4cyrus
@all4cyrus Год назад
I love the way the bike just threw him in the garage as if to say "we gotta do something about that skin John".
@johnbelgium6814
@johnbelgium6814 Год назад
The ominous mysterious music before his transformation, love when movies do that
@MiyaTakamura
@MiyaTakamura 5 месяцев назад
Jason Momoa and everyone involved in making Fast X: Have Mercy. Me: (8:29) Sorry, All Out Of Mercy!
@FortniteDad39
@FortniteDad39 Год назад
Thanos (to Thor): You should've gone for the head Ghost Rider (puts hand on Thanos shoulder): Hey...Dirtbag....
@Luka2000_
@Luka2000_ Год назад
Man I wish that we got an r rated ghost rider movie. This was a good movie but it sadly went unnoticed
@Masked_SVincent
@Masked_SVincent Год назад
I think the writing and storyline could’ve been done better, but I def don’t thinks it’s as bad as people make it to be
@jackratscratpack9323
@jackratscratpack9323 Год назад
Doesn’t need to be r rated don’t need blood with ghost rider he leaves nothing but ash and brimstone and charred skeletons
@dazeitgeist
@dazeitgeist 3 месяца назад
Still one if the best character introductions eveeerrrr!!!
@ChriZzyGoesCraZy
@ChriZzyGoesCraZy 11 месяцев назад
The motorcycle transformation tho 👊😮‍💨
@dmitriciccarelli4082
@dmitriciccarelli4082 Год назад
Love how the bike has its own personality and mind of it's own.
@radheybharadwaj5431
@radheybharadwaj5431 Год назад
That whistle at 09:07 😵
@janethmuganyizi3155
@janethmuganyizi3155 7 месяцев назад
Cartoons...
@ethanwright3626
@ethanwright3626 10 месяцев назад
Underrated movie 💯
@Panzer_John
@Panzer_John 2 месяца назад
You wont believe the happiness I got from watching this
@mulamuerastus9140
@mulamuerastus9140 Год назад
That scene where horse ghost rider & cage go for a ride always gave me goosebumps as a teenager..Movie was great for the 2000s ..But also I felt like it went downhill after the first movie
@cristianpreiti119
@cristianpreiti119 Год назад
I VERY MUCH AGREE WITH YOU,MULAMU....
@icheko2498
@icheko2498 Год назад
8:57 and that kids, is where gravel comes from
@railtrolley
@railtrolley Месяц назад
2:07 Nice bike! Peter Fonda remembering riding the Captain America chopper in Easy Riders?
@law500
@law500 Год назад
Everything about ghost rider is amazing
@millionfps
@millionfps Год назад
i love nicolas cage as johnny great acting you can see how johnny is getting high in the power until he looks at his hands and he realizes hes burning, power and fear fight and fear dies sheeesh i hope we see him again
@abhishekbarua360
@abhishekbarua360 Год назад
Damn i want cage back as the hellrider like toby & andrew
@kunalapte5816
@kunalapte5816 Год назад
Yeah, probably something like a mentor/guide for Robbie as he had Carter Slade for him and maybe even have him transform into the blue rider we saw at the end of SoV.
@abhishekbarua360
@abhishekbarua360 Год назад
@@kunalapte5816 agreed brother🙌
@Cerdo_asqueroso
@Cerdo_asqueroso Год назад
Nicholas Cage should never ever be ghost rider. The only reason why he was in this role was because he annoyed the director day and night to get the role, but that role was supposed to be for Jhonny Depp.
@alecrocksablegaming
@alecrocksablegaming Год назад
@@Cerdo_asqueroso looks like someone doesn’t have taste and is butthurt what’s wrong dad didn’t give you any attention when your younger?
@garvitchauhan6265
@garvitchauhan6265 Год назад
@@Cerdo_asqueroso Just because he was a big fan of Ghost Rider and who doesn't want to be a superhero? I always thought that Nic Cage was good but the writing and direction of the movies were bad.
@lemhanback9595
@lemhanback9595 8 месяцев назад
Not to mention that bike metamorphosis was killer. To bad they changed the bike in the second one 😂😂😂😂
@shadangel47
@shadangel47 Год назад
Ghost Rider 1 had the best Ghost Rider transformation scene, Ghost Rider: Spirit of Vengeance had the best Ghost Rider design
@audax117
@audax117 Год назад
7:50 the camera work, the heavy footsteps, the "whatever" edgelord expression, the cheesy one liner, the green/blue color scheme. This all screams early 2000's and I love it lmao
@Luka2000_
@Luka2000_ Год назад
This literally came out in 2007 wtf are you talking about
@gustavopereira4924
@gustavopereira4924 Год назад
@@Luka2000_ 2000's means movies from 2000 to 2009 fucker
@audax117
@audax117 Год назад
@@Luka2000_ Exactly? 2007 is still early 2000's
@houstonhelicoptertours1006
@houstonhelicoptertours1006 Год назад
@@audax117 No. Stop huffing glue.
@Luka2000_
@Luka2000_ Год назад
@@audax117 literally toilet brain
@bossnationn975
@bossnationn975 Год назад
Demon: have mercy Rider : ooh at of mercy. That line.. Madddd
@minatothefaster1788
@minatothefaster1788 Год назад
Sorry All outta mercy 😄
@tamilpasanga8322
@tamilpasanga8322 7 месяцев назад
Still gives me goosebumps
@Artvy1
@Artvy1 8 месяцев назад
This is definitely my most favorite movie with the marvelous Actor - Nicolas Cage!
Далее
Jail Fight Prison Break | Ghost Rider (2007)
7:29
Просмотров 11 млн
25 ФАКТОВ О СОБАКЕ ЭДИСОНА
32:57
Просмотров 727 тыс.
Ghost Rider Evades The Cops | Ghost Rider | Voyage
5:35
Ghost Rider: Jail fight HD CLIP
5:19
Просмотров 29 млн